Q9HNU1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNU1 - Uncharacterized protein

UniProt:	Q9HNU1	Sequences: MTAYTATVTVRLQHGVLDPEAETTQQALERLGFELDALRSADRFEIDLDADDEQAAAERADEMAHRLLANPTIHDYDVAVEARE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	84 (76)
Sequences:	1239 (659)
Seq/√Len:	75.6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_D	65_H	3.630	1.00
62_E	66_R	2.789	1.00
53_E	57_A	2.298	1.00
50_A	56_A	2.247	1.00
24_T	40_S	2.157	1.00
33_F	63_M	2.007	1.00
16_V	73_I	1.998	1.00
40_S	44_F	1.988	1.00
6_A	80_V	1.902	1.00
9_T	43_R	1.891	1.00
22_E	25_Q	1.846	1.00
7_T	45_E	1.839	1.00
57_A	61_D	1.814	1.00
36_D	49_D	1.753	1.00
7_T	79_A	1.711	1.00
55_A	58_E	1.659	1.00
64_A	76_Y	1.623	1.00
50_A	55_A	1.604	1.00
25_Q	37_A	1.515	0.99
12_L	73_I	1.430	0.99
11_R	77_D	1.428	0.99
28_L	63_M	1.414	0.99
59_R	62_E	1.403	0.99
5_T	47_D	1.382	0.99
9_T	77_D	1.374	0.98
21_A	38_L	1.308	0.98
41_A	74_H	1.230	0.97
7_T	43_R	1.227	0.97
11_R	75_D	1.207	0.96
5_T	45_E	1.185	0.96
28_L	38_L	1.161	0.96
9_T	79_A	1.130	0.95
12_L	72_T	1.128	0.95
6_A	48_L	1.123	0.95
54_Q	57_A	1.102	0.94
20_E	74_H	1.087	0.94
20_E	40_S	1.052	0.93
10_V	44_F	1.050	0.93
21_A	41_A	1.049	0.92
38_L	46_I	1.042	0.92
15_G	40_S	1.015	0.91
11_R	43_R	1.009	0.91
20_E	24_T	0.993	0.90
55_A	59_R	0.979	0.90
61_D	76_Y	0.968	0.89
48_L	56_A	0.957	0.89
4_Y	50_A	0.956	0.88
8_V	46_I	0.946	0.88
60_A	64_A	0.940	0.88
17_L	22_E	0.939	0.88
21_A	42_D	0.926	0.87
37_A	47_D	0.924	0.87
57_A	78_V	0.924	0.87
51_D	55_A	0.895	0.85
24_T	44_F	0.858	0.82
17_L	23_T	0.822	0.80
60_A	78_V	0.797	0.78
22_E	37_A	0.788	0.77
34_E	49_D	0.769	0.75
64_A	78_V	0.767	0.75
65_H	71_P	0.749	0.73
15_G	22_E	0.748	0.73
20_E	41_A	0.745	0.73
25_Q	29_E	0.744	0.73
51_D	56_A	0.740	0.72
36_D	47_D	0.728	0.71
23_T	72_T	0.696	0.67
21_A	39_R	0.691	0.67
4_Y	13_Q	0.685	0.66
58_E	61_D	0.668	0.64
22_E	26_Q	0.666	0.64
36_D	54_Q	0.656	0.63
63_M	67_L	0.648	0.62
33_F	59_R	0.641	0.61
12_L	39_R	0.641	0.61
42_D	74_H	0.637	0.61
4_Y	47_D	0.617	0.58
59_R	63_M	0.615	0.58
35_L	38_L	0.611	0.57
24_T	42_D	0.608	0.57
6_A	56_A	0.595	0.55
25_Q	36_D	0.595	0.55
53_E	80_V	0.589	0.55
69_A	72_T	0.587	0.54
62_E	65_H	0.586	0.54
61_D	78_V	0.583	0.54
23_T	40_S	0.580	0.54
4_Y	17_L	0.576	0.53
64_A	80_V	0.571	0.52
65_H	76_Y	0.562	0.51
18_D	39_R	0.559	0.51
34_E	53_E	0.558	0.51
22_E	30_R	0.554	0.50
26_Q	78_V	0.553	0.50
13_Q	75_D	0.553	0.50
22_E	75_D	0.550	0.50
54_Q	58_E	0.544	0.49
18_D	41_A	0.541	0.49
44_F	72_T	0.540	0.49
27_A	69_A	0.540	0.49
28_L	46_I	0.539	0.48
14_H	37_A	0.527	0.47
15_G	23_T	0.525	0.47
48_L	63_M	0.525	0.47
22_E	63_M	0.516	0.46
33_F	62_E	0.516	0.46
56_A	80_V	0.511	0.45
14_H	80_V	0.511	0.45
15_G	63_M	0.511	0.45
20_E	30_R	0.511	0.45
50_A	53_E	0.504	0.44
58_E	62_E	0.502	0.44
53_E	64_A	0.502	0.44
12_L	15_G	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2dgbA	2	0.9762	100	0.194	Contact Map
1vq3A	4	0.9643	100	0.213	Contact Map
2yx5A	4	0.9643	100	0.215	Contact Map
1gtdA	3	0.9762	100	0.217	Contact Map
1t4aA	3	0.9405	100	0.222	Contact Map
2zw2A	2	0.9881	100	0.223	Contact Map
4lgyA	1	0.9405	93	0.839	Contact Map
2pc6A	2	0.8929	57.1	0.89	Contact Map
2f1fA	4	0.881	53.5	0.892	Contact Map
2fgcA	2	0.8929	49.1	0.895	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.