Q9HNS9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNS9 - Uncharacterized protein

UniProt:	Q9HNS9	Sequences: MPTDDLAWETTATTTAYDCPGFVIRRDETRLPDGTETDYDYLHDGPAVVVLGFTPDGDEVVLIEEWRQAVGRVNRALPAGSVEPGESLAAAARREFREETGYEPATIEQYATYEPANGISDAVHHYFRATDCTPTASQTLDDDETIRVDTEPYDDLVAAVRDDDIRDGRTALGVLQHELA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	180 (168)
Sequences:	5915 (4209)
Seq/√Len:	324.7

ECOLI - NUDE NUDK ADPP
BACSU - ADPP
HALSA - Q9HNS9 Q9HME6
SULSO - Q97WP3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_E	30_R	3.100	1.00
49_V	77_L	2.874	1.00
54_T	59_E	2.578	1.00
14_T	26_R	2.453	1.00
89_A	93_R	2.430	1.00
18_D	23_V	2.397	1.00
106_T	130_T	2.352	1.00
97_R	103_E	2.273	1.00
12_A	28_E	2.095	1.00
59_E	152_P	2.092	1.00
75_R	149_D	2.081	1.00
158_A	162_D	2.080	1.00
156_L	174_V	2.062	1.00
13_T	25_R	2.062	1.00
15_T	18_D	2.048	1.00
108_E	130_T	2.038	1.00
87_S	90_A	2.010	1.00
64_E	147_R	1.958	1.00
59_E	150_T	1.935	1.00
28_E	36_E	1.935	1.00
26_R	38_D	1.932	1.00
109_Q	125_H	1.931	1.00
61_V	150_T	1.931	1.00
112_T	123_V	1.929	1.00
54_T	150_T	1.923	1.00
25_R	43_H	1.862	1.00
105_A	131_D	1.829	1.00
43_H	121_D	1.822	1.00
109_Q	112_T	1.766	1.00
82_V	91_A	1.758	1.00
159_A	164_D	1.733	1.00
86_E	94_R	1.722	1.00
30_R	36_E	1.701	1.00
64_E	149_D	1.698	1.00
105_A	133_T	1.695	1.00
93_R	107_I	1.673	1.00
13_T	27_D	1.670	1.00
50_V	92_A	1.631	1.00
65_E	76_A	1.631	1.00
88_L	125_H	1.607	1.00
19_C	40_D	1.607	1.00
28_E	38_D	1.589	1.00
56_D	59_E	1.586	1.00
151_E	159_A	1.583	1.00
11_T	30_R	1.536	1.00
106_T	131_D	1.530	1.00
152_P	155_D	1.529	1.00
10_T	68_Q	1.519	1.00
112_T	125_H	1.514	1.00
27_D	68_Q	1.457	1.00
155_D	158_A	1.455	1.00
72_R	166_R	1.413	1.00
89_A	107_I	1.395	1.00
114_E	166_R	1.387	1.00
51_L	173_G	1.385	1.00
90_A	93_R	1.353	1.00
91_A	94_R	1.344	1.00
77_L	173_G	1.334	1.00
61_V	102_Y	1.332	1.00
103_E	133_T	1.320	1.00
82_V	88_L	1.312	1.00
26_R	40_D	1.304	1.00
96_F	104_P	1.299	1.00
113_Y	172_L	1.275	1.00
15_T	25_R	1.229	1.00
97_R	135_T	1.228	1.00
78_P	100_T	1.209	1.00
102_Y	134_P	1.199	1.00
93_R	97_R	1.175	1.00
103_E	135_T	1.170	1.00
15_T	23_V	1.158	1.00
151_E	156_L	1.148	1.00
11_T	36_E	1.141	1.00
70_V	114_E	1.136	1.00
88_L	127_F	1.130	1.00
70_V	74_N	1.120	1.00
68_Q	71_G	1.110	1.00
97_R	139_T	1.106	1.00
113_Y	126_Y	1.102	1.00
61_V	148_V	1.099	1.00
160_V	171_A	1.098	1.00
14_T	28_E	1.083	1.00
52_G	96_F	1.057	1.00
86_E	91_A	1.050	1.00
116_A	122_A	1.049	1.00
157_V	161_R	1.044	1.00
109_Q	127_F	1.036	1.00
158_A	161_R	1.035	1.00
46_P	82_V	1.012	1.00
64_E	73_V	0.998	1.00
155_D	159_A	0.992	1.00
66_W	71_G	0.960	1.00
27_D	41_Y	0.951	1.00
110_Y	128_R	0.947	1.00
126_Y	173_G	0.943	1.00
51_L	177_H	0.938	1.00
74_N	117_N	0.938	1.00
48_V	92_A	0.928	1.00
54_T	57_G	0.928	1.00
89_A	109_Q	0.897	1.00
16_A	24_I	0.897	1.00
32_P	145_T	0.886	1.00
16_A	26_R	0.881	1.00
47_A	124_H	0.868	1.00
172_L	175_L	0.860	1.00
104_P	107_I	0.857	1.00
53_F	128_R	0.856	1.00
51_L	60_V	0.855	1.00
167_D	170_T	0.847	1.00
55_P	131_D	0.846	1.00
92_A	107_I	0.845	1.00
22_F	42_L	0.839	1.00
46_P	123_V	0.834	1.00
67_R	76_A	0.834	1.00
157_V	174_V	0.831	1.00
50_V	129_A	0.819	1.00
60_V	177_H	0.819	1.00
107_I	129_A	0.815	1.00
60_V	77_L	0.811	1.00
10_T	27_D	0.806	1.00
107_I	127_F	0.803	1.00
62_L	151_E	0.790	1.00
60_V	174_V	0.784	1.00
17_Y	24_I	0.781	1.00
93_R	103_E	0.776	1.00
115_P	119_I	0.772	1.00
53_F	153_Y	0.770	1.00
42_L	119_I	0.770	1.00
114_E	123_V	0.767	1.00
54_T	102_Y	0.764	1.00
51_L	77_L	0.760	0.99
49_V	126_Y	0.759	0.99
44_D	122_A	0.756	0.99
159_A	162_D	0.749	0.99
49_V	124_H	0.747	0.99
23_V	43_H	0.746	0.99
62_L	149_D	0.742	0.99
62_L	75_R	0.742	0.99
77_L	174_V	0.735	0.99
140_L	143_D	0.735	0.99
49_V	169_R	0.735	0.99
55_P	130_T	0.734	0.99
78_P	96_F	0.733	0.99
41_Y	68_Q	0.727	0.99
75_R	151_E	0.723	0.99
104_P	129_A	0.714	0.99
53_F	60_V	0.708	0.99
10_T	71_G	0.707	0.99
132_C	135_T	0.703	0.99
63_I	146_I	0.702	0.99
46_P	125_H	0.696	0.99
73_V	145_T	0.685	0.99
108_E	128_R	0.685	0.99
62_L	156_L	0.683	0.99
111_A	176_Q	0.682	0.99
156_L	160_V	0.680	0.99
116_A	120_S	0.674	0.99
111_A	172_L	0.673	0.99
113_Y	168_G	0.672	0.99
160_V	165_I	0.672	0.99
14_T	38_D	0.668	0.99
24_I	42_L	0.664	0.99
134_P	137_S	0.655	0.98
53_F	130_T	0.651	0.98
52_G	128_R	0.650	0.98
106_T	109_Q	0.646	0.98
97_R	137_S	0.643	0.98
19_C	26_R	0.642	0.98
137_S	140_L	0.641	0.98
60_V	153_Y	0.639	0.98
123_V	166_R	0.636	0.98
64_E	75_R	0.634	0.98
152_P	157_V	0.633	0.98
52_G	63_I	0.632	0.98
141_D	144_E	0.628	0.98
104_P	131_D	0.626	0.98
124_H	169_R	0.625	0.98
153_Y	157_V	0.625	0.98
52_G	57_G	0.620	0.98
8_W	29_T	0.619	0.98
92_A	127_F	0.616	0.98
165_I	170_T	0.616	0.98
139_T	144_E	0.615	0.98
12_A	15_T	0.614	0.98
13_T	43_H	0.613	0.98
112_T	166_R	0.611	0.98
31_L	37_T	0.609	0.98
92_A	96_F	0.601	0.97
15_T	43_H	0.601	0.97
79_A	169_R	0.601	0.97
11_T	28_E	0.599	0.97
154_D	157_V	0.595	0.97
131_D	135_T	0.594	0.97
115_P	168_G	0.592	0.97
46_P	81_S	0.592	0.97
45_G	81_S	0.591	0.97
47_A	81_S	0.590	0.97
156_L	165_I	0.588	0.97
53_F	177_H	0.588	0.97
115_P	120_S	0.585	0.97
60_V	156_L	0.583	0.97
74_N	114_E	0.583	0.97
48_V	88_L	0.583	0.97
37_T	143_D	0.582	0.97
89_A	127_F	0.581	0.97
54_T	61_V	0.580	0.97
52_G	77_L	0.577	0.97
67_R	118_G	0.576	0.97
55_P	133_T	0.573	0.97
33_D	145_T	0.571	0.96
93_R	104_P	0.571	0.96
79_A	118_G	0.567	0.96
113_Y	171_A	0.565	0.96
10_T	13_T	0.563	0.96
49_V	79_A	0.558	0.96
135_T	138_Q	0.558	0.96
50_V	96_F	0.553	0.96
128_R	176_Q	0.552	0.96
151_E	155_D	0.552	0.96
75_R	159_A	0.548	0.96
111_A	126_Y	0.546	0.95
29_T	37_T	0.546	0.95
50_V	78_P	0.545	0.95
83_E	91_A	0.545	0.95
155_D	164_D	0.542	0.95
111_A	163_D	0.538	0.95
59_E	155_D	0.534	0.95
138_Q	148_V	0.532	0.95
159_A	165_I	0.532	0.95
16_A	40_D	0.531	0.95
172_L	176_Q	0.529	0.95
140_L	144_E	0.527	0.95
111_A	171_A	0.525	0.94
149_D	159_A	0.524	0.94
21_G	44_D	0.523	0.94
82_V	125_H	0.522	0.94
170_T	174_V	0.520	0.94
160_V	174_V	0.520	0.94
87_S	127_F	0.519	0.94
31_L	141_D	0.516	0.94
61_V	100_T	0.515	0.94
29_T	68_Q	0.514	0.94
41_Y	69_A	0.510	0.94
27_D	71_G	0.508	0.93
44_D	119_I	0.507	0.93
140_L	146_I	0.506	0.93
44_D	120_S	0.505	0.93
157_V	160_V	0.504	0.93
88_L	109_Q	0.503	0.93
44_D	79_A	0.502	0.93
33_D	143_D	0.502	0.93
137_S	154_D	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1g0sA	2	0.9944	100	0.286	Contact Map
2dscA	2	0.9667	100	0.297	Contact Map
1vhzA	2	0.9833	100	0.299	Contact Map
1mk1A	2	0.8778	100	0.354	Contact Map
3o6zA	2	0.9611	100	0.388	Contact Map
2yvpA	2	0.9556	100	0.4	Contact Map
1v8yA	2	0.8167	100	0.439	Contact Map
3q91A	2	0.7056	100	0.47	Contact Map
2w4eA	2	0.7222	99.9	0.531	Contact Map
2fvvA	1	0.75	99.9	0.558	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.