Q9HNS0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNS0 - Uncharacterized protein

UniProt:	Q9HNS0	Sequences: MRAATSVTAVVLMVAVVVVLAGTVAVFTLGSTDTISSPAPLIGQTSGELVRDTAGGGDQIVRLTHIAGDDVAVSDLDVVVDATAACGKRARIVDLPTSTLGPSTYDGDKLFDFYSPDGGAFDANTDGVWRPGETATFRIANRDCSLDSGDTITVRVVHTPSETVVIEDTLTAS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	173 (142)
Sequences:	115 (108)
Seq/√Len:	9.0

HALSA - Q9HNS0 Q9HHE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_V	24_V	3.318	0.94
15_A	20_L	2.895	0.89
28_T	32_T	2.651	0.84
9_A	17_V	2.612	0.83
11_V	15_A	2.512	0.80
17_V	23_T	2.475	0.79
11_V	14_V	2.446	0.79
24_V	28_T	2.316	0.74
10_V	17_V	2.234	0.72
33_D	37_S	2.184	0.70
8_T	13_M	2.021	0.64
10_V	23_T	2.013	0.63
4_A	8_T	1.967	0.61
4_A	22_G	1.912	0.59
26_V	34_T	1.842	0.56
8_T	28_T	1.809	0.55
31_S	34_T	1.804	0.54
5_T	12_L	1.771	0.53
14_V	24_V	1.739	0.52
20_L	29_L	1.714	0.51
19_V	28_T	1.690	0.49
16_V	20_L	1.672	0.49
16_V	24_V	1.651	0.48
7_V	21_A	1.642	0.47
4_A	7_V	1.639	0.47
63_L	78_V	1.629	0.47
15_A	29_L	1.626	0.47
18_V	28_T	1.534	0.43
100_L	106_D	1.528	0.42
14_V	28_T	1.513	0.42
34_T	49_L	1.492	0.41
33_D	36_S	1.476	0.40
5_T	8_T	1.457	0.39
3_A	39_A	1.455	0.39
19_V	22_G	1.435	0.39
107_G	112_D	1.432	0.38
11_V	16_V	1.406	0.37
3_A	12_L	1.395	0.37
11_V	20_L	1.380	0.36
6_S	9_A	1.353	0.35
25_A	28_T	1.346	0.35
15_A	24_V	1.345	0.35
18_V	29_L	1.338	0.35
8_T	22_G	1.330	0.34
30_G	34_T	1.294	0.33
140_A	145_S	1.288	0.33
47_G	61_V	1.273	0.32
67_A	139_I	1.262	0.32
19_V	24_V	1.242	0.31
58_D	70_D	1.241	0.31
24_V	32_T	1.235	0.31
25_A	66_I	1.231	0.31
28_T	48_E	1.224	0.30
13_M	39_A	1.218	0.30
67_A	145_S	1.208	0.30
40_P	65_H	1.204	0.30
18_V	32_T	1.196	0.29
6_S	12_L	1.186	0.29
40_P	68_G	1.172	0.28
16_V	27_F	1.172	0.28
49_L	61_V	1.171	0.28
6_S	19_V	1.167	0.28
41_L	44_Q	1.164	0.28
6_S	11_V	1.161	0.28
67_A	71_V	1.158	0.28
100_L	104_T	1.091	0.26
71_V	137_F	1.084	0.25
8_T	26_V	1.083	0.25
5_T	9_A	1.077	0.25
5_T	19_V	1.067	0.25
14_V	18_V	1.063	0.25
97_T	104_T	1.053	0.24
93_V	135_A	1.047	0.24
14_V	20_L	1.045	0.24
29_L	64_T	1.043	0.24
16_V	29_L	1.033	0.24
77_D	80_V	1.033	0.24
13_M	27_F	1.033	0.24
3_A	8_T	1.025	0.24
7_V	10_V	1.023	0.23
93_V	109_K	1.007	0.23
11_V	19_V	0.995	0.23
25_A	36_S	0.965	0.22
13_M	22_G	0.953	0.21
98_S	110_L	0.936	0.21
21_A	43_G	0.931	0.21
13_M	28_T	0.926	0.21
25_A	79_V	0.926	0.21
5_T	10_V	0.924	0.21
92_I	107_G	0.921	0.20
9_A	23_T	0.911	0.20
17_V	43_G	0.910	0.20
18_V	24_V	0.901	0.20
62_R	73_V	0.899	0.20
17_V	67_A	0.897	0.20
10_V	13_M	0.894	0.20
92_I	137_F	0.892	0.20
15_A	27_F	0.888	0.20
17_V	25_A	0.876	0.19
113_F	116_P	0.868	0.19
39_A	43_G	0.864	0.19
11_V	28_T	0.855	0.19
14_V	29_L	0.852	0.19
19_V	71_V	0.852	0.19
61_V	75_D	0.845	0.18
66_I	75_D	0.838	0.18
37_S	70_D	0.834	0.18
8_T	11_V	0.833	0.18
9_A	43_G	0.815	0.18
29_L	49_L	0.802	0.17
73_V	138_R	0.801	0.17
15_A	32_T	0.799	0.17
30_G	44_Q	0.793	0.17
59_Q	133_E	0.793	0.17
87_G	104_T	0.790	0.17
30_G	40_P	0.788	0.17
61_V	132_G	0.786	0.17
9_A	25_A	0.785	0.17
15_A	18_V	0.784	0.17
16_V	25_A	0.778	0.17
41_L	142_R	0.777	0.17
136_T	139_I	0.776	0.17
44_Q	71_V	0.774	0.17
117_D	133_E	0.765	0.16
31_S	44_Q	0.758	0.16
65_H	68_G	0.755	0.16
46_S	66_I	0.750	0.16
26_V	30_G	0.744	0.16
3_A	18_V	0.737	0.16
23_T	38_P	0.729	0.16
5_T	17_V	0.727	0.15
7_V	19_V	0.723	0.15
114_Y	118_G	0.717	0.15
45_T	69_D	0.706	0.15
57_G	145_S	0.705	0.15
45_T	138_R	0.696	0.15
9_A	67_A	0.696	0.15
8_T	38_P	0.694	0.15
24_V	115_S	0.693	0.15
29_L	76_L	0.692	0.15
116_P	119_G	0.689	0.15
105_Y	108_D	0.680	0.14
56_G	103_S	0.674	0.14
24_V	119_G	0.672	0.14
39_A	45_T	0.672	0.14
27_F	43_G	0.669	0.14
29_L	48_E	0.662	0.14
74_S	126_D	0.661	0.14
7_V	11_V	0.658	0.14
13_M	19_V	0.642	0.14
57_G	74_S	0.641	0.14
6_S	10_V	0.640	0.14
61_V	135_A	0.639	0.14
61_V	133_E	0.632	0.13
45_T	64_T	0.629	0.13
62_R	106_D	0.628	0.13
5_T	38_P	0.625	0.13
115_S	120_A	0.625	0.13
5_T	32_T	0.623	0.13
20_L	28_T	0.619	0.13
15_A	19_V	0.617	0.13
12_L	17_V	0.617	0.13
5_T	24_V	0.610	0.13
21_A	41_L	0.610	0.13
15_A	28_T	0.607	0.13
3_A	6_S	0.606	0.13
9_A	12_L	0.600	0.13
82_A	139_I	0.600	0.13
5_T	18_V	0.599	0.13
25_A	32_T	0.595	0.13
63_L	109_K	0.587	0.13
122_D	128_V	0.583	0.12
7_V	12_L	0.583	0.12
10_V	21_A	0.581	0.12
30_G	36_S	0.575	0.12
76_L	111_F	0.575	0.12
81_D	101_G	0.573	0.12
47_G	91_R	0.571	0.12
47_G	63_L	0.569	0.12
69_D	108_D	0.568	0.12
26_V	31_S	0.564	0.12
102_P	109_K	0.563	0.12
13_M	26_V	0.562	0.12
72_A	97_T	0.561	0.12
89_R	95_L	0.556	0.12
6_S	24_V	0.553	0.12
25_A	67_A	0.552	0.12
23_T	27_F	0.551	0.12
62_R	81_D	0.547	0.12
13_M	47_G	0.547	0.12
17_V	26_V	0.546	0.12
129_W	132_G	0.546	0.12
17_V	21_A	0.544	0.12
135_A	141_N	0.544	0.12
100_L	107_G	0.541	0.12
63_L	147_D	0.540	0.12
11_V	18_V	0.539	0.12
31_S	38_P	0.532	0.12
19_V	32_T	0.527	0.11
104_T	122_D	0.523	0.11
55_G	88_K	0.522	0.11
123_A	134_T	0.522	0.11
51_R	78_V	0.521	0.11
11_V	32_T	0.517	0.11
11_V	29_L	0.515	0.11
4_A	10_V	0.515	0.11
26_V	38_P	0.514	0.11
70_D	74_S	0.513	0.11
38_P	44_Q	0.512	0.11
79_V	90_A	0.509	0.11
13_M	18_V	0.508	0.11
19_V	27_F	0.502	0.11
116_P	121_F	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j1rA	5	0.1503	21.3	0.943	Contact Map
3isyA	1	0.6243	15	0.947	Contact Map
1g43A	1	0.7341	13.3	0.948	Contact Map
2p9rA	1	0.3295	13.1	0.948	Contact Map
2wnxA	2	0.711	9.8	0.951	Contact Map
2xbtA	1	0.6994	3.8	0.96	Contact Map
3vmnA	1	0.3295	3.7	0.96	Contact Map
3zjaA	1	0.6185	3.4	0.961	Contact Map
3umnA	1	0.6705	3.1	0.961	Contact Map
4tp9P	1	0.2659	2.8	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.