Q9HNR9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNR9 - Uncharacterized protein

UniProt:	Q9HNR9	Sequences: MFPIDYHILEFYEDHDIQASPKIVAANIDYDRQYTGRRLKALAEAGLFKREGDGIYSLSDLGRGFLSGEVDPNELEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	77 (76)
Sequences:	108 (72)
Seq/√Len:	8.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_L	48_F	3.111	0.90
65_F	70_V	2.139	0.64
12_Y	48_F	2.126	0.64
20_S	23_I	2.016	0.59
72_P	76_E	1.995	0.58
14_D	49_K	1.762	0.49
19_A	32_R	1.724	0.47
11_F	17_I	1.712	0.47
44_E	73_N	1.641	0.44
24_V	29_D	1.635	0.44
6_Y	41_A	1.607	0.43
60_D	76_E	1.573	0.41
11_F	28_I	1.570	0.41
69_E	74_E	1.559	0.41
61_L	69_E	1.506	0.38
52_G	59_S	1.466	0.37
70_V	74_E	1.454	0.36
57_S	73_N	1.450	0.36
17_I	48_F	1.433	0.36
4_I	72_P	1.401	0.34
20_S	69_E	1.357	0.33
30_Y	45_A	1.351	0.33
11_F	19_A	1.344	0.32
15_H	58_L	1.320	0.31
25_A	32_R	1.317	0.31
16_D	57_S	1.310	0.31
61_L	73_N	1.300	0.31
6_Y	38_R	1.273	0.30
39_L	54_G	1.261	0.29
17_I	23_I	1.234	0.28
4_I	34_Y	1.196	0.27
26_A	52_G	1.178	0.27
60_D	63_R	1.170	0.26
67_S	70_V	1.145	0.26
47_L	70_V	1.143	0.25
20_S	25_A	1.141	0.25
3_P	33_Q	1.138	0.25
28_I	42_L	1.132	0.25
26_A	55_I	1.131	0.25
1_M	30_Y	1.114	0.25
20_S	36_G	1.104	0.24
4_I	32_R	1.058	0.23
7_H	44_E	1.053	0.23
63_R	74_E	1.048	0.23
22_K	64_G	1.034	0.22
35_T	73_N	1.025	0.22
47_L	75_L	0.985	0.21
6_Y	65_F	0.980	0.21
12_Y	72_P	0.972	0.20
21_P	72_P	0.965	0.20
9_L	12_Y	0.947	0.20
16_D	45_A	0.936	0.20
38_R	58_L	0.935	0.19
27_N	42_L	0.919	0.19
34_Y	39_L	0.907	0.19
67_S	71_D	0.894	0.18
11_F	30_Y	0.883	0.18
3_P	30_Y	0.862	0.18
28_I	40_K	0.857	0.18
60_D	72_P	0.841	0.17
3_P	32_R	0.826	0.17
28_I	46_G	0.824	0.17
19_A	24_V	0.818	0.17
15_H	19_A	0.810	0.16
16_D	24_V	0.801	0.16
6_Y	12_Y	0.786	0.16
43_A	50_R	0.780	0.16
71_D	75_L	0.778	0.16
24_V	55_I	0.776	0.16
21_P	32_R	0.762	0.15
25_A	43_A	0.755	0.15
35_T	54_G	0.748	0.15
24_V	69_E	0.743	0.15
18_Q	41_A	0.738	0.15
13_E	69_E	0.729	0.15
39_L	58_L	0.728	0.15
28_I	68_G	0.714	0.14
17_I	49_K	0.713	0.14
28_I	38_R	0.708	0.14
7_H	15_H	0.706	0.14
1_M	28_I	0.700	0.14
49_K	57_S	0.698	0.14
22_K	53_D	0.691	0.14
22_K	74_E	0.689	0.14
21_P	70_V	0.675	0.14
16_D	30_Y	0.665	0.13
7_H	58_L	0.654	0.13
16_D	55_I	0.653	0.13
28_I	33_Q	0.639	0.13
7_H	36_G	0.629	0.13
27_N	62_G	0.624	0.13
11_F	34_Y	0.614	0.12
30_Y	55_I	0.613	0.12
3_P	44_E	0.605	0.12
31_D	37_R	0.603	0.12
3_P	31_D	0.602	0.12
22_K	34_Y	0.594	0.12
14_D	33_Q	0.593	0.12
25_A	51_E	0.592	0.12
26_A	45_A	0.579	0.12
4_I	30_Y	0.569	0.12
10_E	58_L	0.566	0.12
21_P	75_L	0.562	0.12
35_T	59_S	0.547	0.11
51_E	63_R	0.545	0.11
8_I	57_S	0.533	0.11
20_S	26_A	0.531	0.11
30_Y	34_Y	0.528	0.11
16_D	65_F	0.508	0.11
30_Y	40_K	0.507	0.11
5_D	9_L	0.507	0.11
14_D	41_A	0.503	0.11
6_Y	31_D	0.500	0.11
1_M	41_A	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3b73A	2	0.987	98.5	0.708	Contact Map
1xmkA	1	0.8831	98.4	0.713	Contact Map
1s3jA	2	0.987	98.3	0.724	Contact Map
3bddA	2	0.987	98.3	0.725	Contact Map
1bjaA	1	0.974	98.3	0.726	Contact Map
1r7jA	2	0.9481	98.2	0.727	Contact Map
2lnbA	1	0.8312	98.2	0.729	Contact Map
1oyiA	1	0.7532	98.2	0.729	Contact Map
2ethA	4	0.987	98.2	0.73	Contact Map
2nyxA	2	0.987	98.2	0.73	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.