Q9HNP2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNP2 - 30S ribosomal protein S19e

UniProt:	Q9HNP2	Sequences: MATLYDAPVDELIDELAADLETRLDEPDWANYAKTGAGRELPPEQSDFWATRAASLLRKVAIDGPIGVKRLSEAYGSTTSGSNRYVVAPSTTTAGSRNIVRTILQQLEAEGLVEQQHDHGRVVTGDGRSLLDETAGDVIESLDRPELERYA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (137)
Sequences:	451 (301)
Seq/√Len:	25.7

HALSA - Q9HNP2
SULSO - Q980F7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_S	97_R	5.622	1.00
55_S	75_Y	5.342	1.00
53_A	103_I	4.703	1.00
9_V	13_I	3.980	1.00
49_W	106_Q	3.263	1.00
114_E	122_V	2.679	0.99
72_S	94_A	2.631	0.99
38_G	77_S	2.512	0.99
57_L	112_L	2.347	0.98
95_G	100_V	2.200	0.97
98_N	102_T	2.163	0.97
60_V	123_V	2.136	0.97
45_Q	51_T	2.131	0.97
85_Y	91_T	2.000	0.95
5_Y	62_I	1.985	0.95
102_T	105_Q	1.870	0.93
59_K	63_D	1.785	0.91
21_E	47_D	1.775	0.91
84_R	90_S	1.709	0.90
12_L	16_L	1.706	0.89
36_G	39_R	1.653	0.88
16_L	112_L	1.641	0.88
29_W	33_A	1.620	0.87
10_D	13_I	1.615	0.87
60_V	71_L	1.601	0.86
78_T	90_S	1.583	0.86
16_L	130_L	1.501	0.82
79_T	93_T	1.491	0.82
71_L	74_A	1.458	0.80
113_V	123_V	1.346	0.75
17_A	51_T	1.338	0.74
130_L	134_T	1.309	0.73
66_I	71_L	1.282	0.71
3_T	6_D	1.278	0.71
15_E	137_D	1.251	0.69
56_L	100_V	1.238	0.68
48_F	61_A	1.235	0.68
8_P	11_E	1.211	0.67
101_R	121_R	1.190	0.65
2_A	136_G	1.182	0.65
60_V	113_V	1.180	0.64
26_E	106_Q	1.164	0.63
33_A	99_I	1.157	0.63
76_G	92_T	1.145	0.62
49_W	102_T	1.135	0.61
129_S	133_E	1.130	0.61
2_A	63_D	1.128	0.61
104_L	113_V	1.122	0.60
56_L	71_L	1.099	0.59
105_Q	108_E	1.096	0.59
59_K	73_E	1.094	0.58
111_G	141_S	1.082	0.58
4_L	21_E	1.070	0.57
96_S	99_I	1.060	0.56
108_E	115_Q	1.059	0.56
26_E	102_T	1.055	0.56
75_Y	113_V	1.032	0.54
122_V	128_R	1.020	0.53
114_E	124_T	1.019	0.53
64_G	95_G	1.013	0.53
60_V	66_I	1.011	0.52
4_L	12_L	0.983	0.50
7_A	137_D	0.974	0.50
36_G	76_G	0.969	0.49
24_L	71_L	0.968	0.49
120_G	127_G	0.965	0.49
58_R	121_R	0.955	0.48
94_A	97_R	0.950	0.48
2_A	99_I	0.948	0.48
12_L	44_E	0.944	0.48
15_E	18_A	0.938	0.47
16_L	57_L	0.934	0.47
84_R	87_V	0.927	0.46
59_K	74_A	0.926	0.46
94_A	118_D	0.917	0.46
14_D	45_Q	0.907	0.45
3_T	124_T	0.900	0.44
128_R	132_D	0.892	0.44
132_D	135_A	0.881	0.43
55_S	60_V	0.879	0.43
3_T	62_I	0.874	0.42
61_A	132_D	0.867	0.42
77_S	107_L	0.866	0.42
38_G	93_T	0.864	0.42
23_R	110_E	0.863	0.42
35_T	43_P	0.853	0.41
111_G	126_D	0.852	0.41
130_L	133_E	0.850	0.41
97_R	103_I	0.846	0.40
85_Y	88_A	0.845	0.40
63_D	73_E	0.839	0.40
2_A	5_Y	0.836	0.40
53_A	110_E	0.828	0.39
56_L	116_Q	0.825	0.39
2_A	139_I	0.815	0.38
62_I	110_E	0.806	0.38
10_D	79_T	0.805	0.38
68_V	96_S	0.799	0.37
8_P	116_Q	0.792	0.37
38_G	86_V	0.783	0.36
3_T	138_V	0.781	0.36
24_L	109_A	0.781	0.36
124_T	142_L	0.777	0.36
11_E	41_L	0.759	0.34
48_F	85_Y	0.756	0.34
95_G	98_N	0.753	0.34
17_A	132_D	0.746	0.34
16_L	103_I	0.738	0.33
105_Q	135_A	0.734	0.33
31_N	39_R	0.729	0.33
55_S	136_G	0.725	0.32
36_G	47_D	0.724	0.32
24_L	126_D	0.723	0.32
68_V	104_L	0.723	0.32
48_F	86_V	0.716	0.32
25_D	28_D	0.715	0.32
125_G	129_S	0.714	0.32
126_D	131_L	0.712	0.31
38_G	64_G	0.712	0.31
116_Q	119_H	0.711	0.31
19_D	134_T	0.707	0.31
61_A	121_R	0.703	0.31
121_R	127_G	0.701	0.31
17_A	67_G	0.695	0.30
131_L	134_T	0.693	0.30
33_A	90_S	0.688	0.30
106_Q	111_G	0.688	0.30
129_S	134_T	0.685	0.30
111_G	140_E	0.682	0.30
56_L	103_I	0.679	0.29
137_D	142_L	0.675	0.29
97_R	118_D	0.672	0.29
6_D	132_D	0.671	0.29
129_S	132_D	0.670	0.29
106_Q	110_E	0.667	0.29
66_I	73_E	0.663	0.28
21_E	45_Q	0.654	0.28
13_I	116_Q	0.652	0.28
114_E	125_G	0.646	0.27
128_R	138_V	0.645	0.27
30_A	110_E	0.645	0.27
71_L	100_V	0.644	0.27
37_A	79_T	0.643	0.27
26_E	98_N	0.643	0.27
14_D	87_V	0.640	0.27
11_E	140_E	0.635	0.27
21_E	50_A	0.634	0.27
36_G	94_A	0.629	0.26
37_A	93_T	0.628	0.26
13_I	20_L	0.627	0.26
26_E	49_W	0.627	0.26
111_G	133_E	0.627	0.26
33_A	43_P	0.627	0.26
64_G	123_V	0.626	0.26
24_L	106_Q	0.621	0.26
21_E	86_V	0.621	0.26
6_D	135_A	0.620	0.26
98_N	116_Q	0.618	0.26
36_G	77_S	0.611	0.25
104_L	124_T	0.602	0.25
59_K	66_I	0.602	0.25
11_E	109_A	0.599	0.25
7_A	20_L	0.596	0.25
60_V	109_A	0.595	0.25
19_D	22_T	0.594	0.24
108_E	121_R	0.590	0.24
52_R	76_G	0.589	0.24
26_E	31_N	0.586	0.24
50_A	102_T	0.583	0.24
55_S	59_K	0.581	0.24
14_D	46_S	0.580	0.24
109_A	122_V	0.580	0.24
6_D	23_R	0.578	0.24
3_T	128_R	0.577	0.24
77_S	92_T	0.571	0.23
59_K	75_Y	0.567	0.23
32_Y	49_W	0.567	0.23
95_G	124_T	0.566	0.23
56_L	70_R	0.563	0.23
23_R	69_K	0.562	0.23
66_I	106_Q	0.559	0.23
30_A	106_Q	0.554	0.22
46_S	119_H	0.545	0.22
69_K	94_A	0.541	0.22
76_G	107_L	0.538	0.22
23_R	128_R	0.537	0.22
8_P	19_D	0.535	0.21
5_Y	28_D	0.535	0.21
35_T	39_R	0.535	0.21
31_N	41_L	0.531	0.21
121_R	135_A	0.530	0.21
13_I	124_T	0.529	0.21
2_A	19_D	0.524	0.21
4_L	130_L	0.524	0.21
101_R	135_A	0.521	0.21
77_S	132_D	0.520	0.21
87_V	91_T	0.519	0.21
63_D	66_I	0.518	0.21
16_L	20_L	0.516	0.20
33_A	98_N	0.511	0.20
29_W	38_G	0.510	0.20
56_L	87_V	0.508	0.20
10_D	15_E	0.504	0.20
5_Y	9_V	0.503	0.20
22_T	63_D	0.501	0.20
39_R	57_L	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4bpeT	1	0.9404	100	0.097	Contact Map
4w23T	1	0.9205	100	0.1	Contact Map
3j38T	1	0.9669	100	0.1	Contact Map
3j7aY	1	0.9272	100	0.109	Contact Map
3j60T	1	0.9205	100	0.114	Contact Map
3zeyO	1	0.9603	100	0.118	Contact Map
4ujpU	1	0.9205	100	0.124	Contact Map
2v7fA	1	0.894	100	0.426	Contact Map
1bjaA	1	0.6225	96.7	0.889	Contact Map
2o0mA	1	0.0861	96.5	0.892	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.