Q9HNN9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNN9 - Uncharacterized protein

UniProt:	Q9HNN9	Sequences: MSAPNSPSSEAESQDKETRLKSYLREKADDGELYFKSKFIADDVDLSPKEIGALMVKLSKSATDITVEKWSYTSATTWRVQPA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	83 (74)
Sequences:	144 (88)
Seq/√Len:	10.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
44_V	73_T	2.367	0.81
53_A	75_A	2.245	0.77
14_Q	22_S	2.082	0.71
9_S	58_L	1.737	0.57
15_D	81_Q	1.710	0.55
66_T	81_Q	1.699	0.55
60_K	66_T	1.588	0.50
36_K	72_Y	1.565	0.49
64_D	80_V	1.552	0.48
18_T	81_Q	1.546	0.48
38_K	79_R	1.545	0.48
14_Q	23_Y	1.521	0.47
55_M	74_S	1.491	0.45
51_I	54_L	1.483	0.45
8_S	11_A	1.423	0.42
38_K	71_S	1.405	0.41
22_S	60_K	1.404	0.41
46_L	60_K	1.404	0.41
16_K	50_E	1.399	0.41
25_R	65_I	1.359	0.39
50_E	74_S	1.353	0.39
54_L	73_T	1.343	0.39
22_S	66_T	1.332	0.38
55_M	67_V	1.313	0.37
11_A	45_D	1.303	0.37
20_L	51_I	1.262	0.35
25_R	64_D	1.261	0.35
41_A	75_A	1.250	0.35
47_S	64_D	1.243	0.34
31_G	38_K	1.238	0.34
51_I	73_T	1.230	0.34
35_F	40_I	1.213	0.33
37_S	43_D	1.210	0.33
19_R	42_D	1.203	0.33
58_L	67_V	1.190	0.32
69_K	74_S	1.175	0.32
19_R	69_K	1.156	0.31
10_E	29_D	1.151	0.31
8_S	22_S	1.109	0.29
10_E	22_S	1.097	0.28
17_E	61_S	1.090	0.28
36_K	50_E	1.059	0.27
36_K	54_L	1.050	0.27
8_S	29_D	1.042	0.26
17_E	57_K	1.031	0.26
17_E	54_L	1.020	0.26
55_M	60_K	1.009	0.25
62_A	67_V	0.978	0.24
34_Y	70_W	0.975	0.24
44_V	51_I	0.975	0.24
41_A	53_A	0.936	0.23
12_E	42_D	0.934	0.23
39_F	71_S	0.929	0.23
50_E	54_L	0.921	0.22
35_F	45_D	0.920	0.22
51_I	75_A	0.898	0.22
33_L	74_S	0.897	0.22
36_K	43_D	0.894	0.21
44_V	61_S	0.887	0.21
22_S	29_D	0.878	0.21
23_Y	80_V	0.874	0.21
8_S	26_E	0.866	0.21
71_S	79_R	0.863	0.21
44_V	54_L	0.835	0.20
12_E	69_K	0.832	0.20
16_K	64_D	0.828	0.19
10_E	18_T	0.827	0.19
25_R	80_V	0.815	0.19
59_S	64_D	0.808	0.19
17_E	50_E	0.794	0.19
65_I	79_R	0.793	0.18
42_D	62_A	0.787	0.18
42_D	67_V	0.781	0.18
13_S	33_L	0.772	0.18
11_A	65_I	0.740	0.17
28_A	64_D	0.731	0.17
39_F	54_L	0.722	0.17
24_L	35_F	0.722	0.17
29_D	80_V	0.709	0.16
19_R	61_S	0.709	0.16
18_T	69_K	0.707	0.16
43_D	72_Y	0.694	0.16
20_L	75_A	0.693	0.16
10_E	15_D	0.683	0.16
16_K	36_K	0.674	0.15
54_L	72_Y	0.674	0.15
19_R	46_L	0.656	0.15
40_I	49_K	0.651	0.15
50_E	72_Y	0.648	0.15
39_F	73_T	0.642	0.15
45_D	75_A	0.642	0.15
8_S	12_E	0.640	0.15
39_F	51_I	0.634	0.14
23_Y	66_T	0.629	0.14
20_L	54_L	0.626	0.14
16_K	72_Y	0.625	0.14
43_D	79_R	0.602	0.14
15_D	18_T	0.591	0.13
30_D	42_D	0.585	0.13
22_S	69_K	0.576	0.13
37_S	65_I	0.571	0.13
43_D	81_Q	0.552	0.13
13_S	51_I	0.552	0.13
9_S	45_D	0.543	0.12
11_A	22_S	0.543	0.12
13_S	38_K	0.529	0.12
12_E	65_I	0.525	0.12
39_F	74_S	0.513	0.12
15_D	66_T	0.510	0.12
36_K	55_M	0.500	0.12
19_R	68_E	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qgpA	1	0.9036	90.9	0.858	Contact Map
3eyiA	1	0.747	89.6	0.862	Contact Map
1qbjA	1	0.7831	87.7	0.866	Contact Map
1xmkA	1	0.8434	77.2	0.882	Contact Map
1oyiA	1	0.747	76.2	0.883	Contact Map
4un1A	1	0.8434	76.1	0.883	Contact Map
3lmmA	1	0.8916	75.5	0.883	Contact Map
4ou0A	1	0.7831	74.2	0.884	Contact Map
4ch7A	1	0.8193	72.6	0.886	Contact Map
2ia0A	2	0.7952	71.9	0.887	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.