RS24 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS24 - 30S ribosomal protein S24e

UniProt:	Q9HNL4	Sequences: MEIEILGQEDNPLLHRTDVQFKIVHDDATPSRLSVRDSLAAKLDKDSEEVVVHELDTKFGMRKTRGRAKVYDSPAQAAEVEHDHMLERNKIGADDADAEEAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (97)
Sequences:	162 (124)
Seq/√Len:	12.6

HALSA - RS24
SULSO - RS24

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_Q	17_T	4.369	1.00
32_R	88_R	4.034	1.00
21_F	66_G	3.797	0.99
25_H	64_T	3.461	0.99
77_A	86_L	2.446	0.89
43_L	70_V	2.108	0.80
38_S	42_K	2.082	0.79
25_H	57_T	1.984	0.76
84_H	88_R	1.892	0.72
52_V	92_G	1.806	0.69
45_K	62_R	1.756	0.66
55_L	64_T	1.705	0.64
14_L	59_F	1.681	0.63
21_F	68_A	1.675	0.63
46_D	74_P	1.660	0.62
74_P	78_A	1.645	0.61
13_L	18_D	1.631	0.60
53_H	67_R	1.626	0.60
23_I	50_V	1.616	0.60
39_L	50_V	1.538	0.56
87_E	90_K	1.536	0.56
40_A	88_R	1.533	0.56
83_D	87_E	1.504	0.54
52_V	68_A	1.502	0.54
22_K	63_K	1.466	0.52
47_S	88_R	1.364	0.47
49_E	74_P	1.344	0.46
10_D	72_D	1.299	0.44
34_S	77_A	1.275	0.42
32_R	84_H	1.257	0.41
14_L	80_V	1.249	0.41
53_H	57_T	1.192	0.38
38_S	41_A	1.166	0.37
12_P	87_E	1.157	0.37
86_L	91_I	1.155	0.36
23_I	96_A	1.134	0.35
5_I	43_L	1.129	0.35
42_K	77_A	1.116	0.35
7_G	48_E	1.110	0.34
36_R	89_N	1.093	0.34
5_I	8_Q	1.079	0.33
59_F	72_D	1.049	0.32
48_E	74_P	1.049	0.32
58_K	61_M	1.038	0.31
4_E	19_V	1.029	0.31
76_Q	79_E	1.020	0.30
29_T	40_A	1.015	0.30
41_A	74_P	0.997	0.29
50_V	77_A	0.996	0.29
4_E	65_R	0.996	0.29
57_T	88_R	0.986	0.29
46_D	94_D	0.977	0.28
2_E	48_E	0.959	0.28
45_K	57_T	0.943	0.27
19_V	58_K	0.935	0.27
31_S	55_L	0.922	0.26
39_L	68_A	0.919	0.26
5_I	75_A	0.916	0.26
2_E	23_I	0.906	0.26
77_A	89_N	0.906	0.26
55_L	91_I	0.895	0.25
40_A	64_T	0.887	0.25
35_V	39_L	0.885	0.25
8_Q	83_D	0.878	0.24
42_K	51_V	0.854	0.24
3_I	37_D	0.854	0.24
34_S	97_D	0.836	0.23
31_S	87_E	0.831	0.23
9_E	92_G	0.823	0.22
59_F	62_R	0.817	0.22
38_S	77_A	0.812	0.22
25_H	40_A	0.806	0.22
46_D	90_K	0.801	0.22
1_M	41_A	0.800	0.22
32_R	40_A	0.791	0.21
17_T	70_V	0.784	0.21
87_E	94_D	0.770	0.21
2_E	77_A	0.767	0.21
36_R	57_T	0.763	0.20
5_I	86_L	0.743	0.20
42_K	46_D	0.730	0.19
67_R	86_L	0.729	0.19
31_S	50_V	0.722	0.19
44_D	82_H	0.717	0.19
28_A	68_A	0.711	0.19
2_E	9_E	0.711	0.19
35_V	80_V	0.710	0.19
20_Q	70_V	0.707	0.19
44_D	78_A	0.702	0.18
37_D	40_A	0.688	0.18
85_M	88_R	0.681	0.18
52_V	85_M	0.680	0.18
85_M	89_N	0.676	0.18
41_A	44_D	0.675	0.18
7_G	54_E	0.667	0.17
58_K	79_E	0.665	0.17
6_L	65_R	0.657	0.17
40_A	77_A	0.657	0.17
52_V	67_R	0.655	0.17
48_E	52_V	0.642	0.17
69_K	89_N	0.640	0.17
4_E	13_L	0.639	0.17
19_V	73_S	0.637	0.16
53_H	69_K	0.632	0.16
13_L	82_H	0.629	0.16
59_F	79_E	0.629	0.16
20_Q	56_D	0.628	0.16
5_I	95_D	0.617	0.16
40_A	50_V	0.616	0.16
4_E	54_E	0.611	0.16
14_L	56_D	0.605	0.16
33_L	95_D	0.602	0.16
77_A	91_I	0.595	0.15
36_R	88_R	0.585	0.15
19_V	44_D	0.576	0.15
63_K	73_S	0.574	0.15
40_A	51_V	0.572	0.15
64_T	68_A	0.571	0.15
16_R	71_Y	0.565	0.15
60_G	71_Y	0.565	0.15
11_N	60_G	0.565	0.15
11_N	16_R	0.565	0.15
11_N	71_Y	0.565	0.15
16_R	60_G	0.565	0.15
9_E	53_H	0.564	0.15
67_R	89_N	0.563	0.14
29_T	44_D	0.558	0.14
87_E	91_I	0.557	0.14
34_S	37_D	0.556	0.14
6_L	20_Q	0.548	0.14
41_A	59_F	0.547	0.14
51_V	80_V	0.547	0.14
22_K	65_R	0.544	0.14
52_V	89_N	0.540	0.14
4_E	22_K	0.538	0.14
17_T	44_D	0.530	0.14
32_R	36_R	0.530	0.14
2_E	14_L	0.529	0.14
82_H	88_R	0.522	0.13
57_T	82_H	0.518	0.13
36_R	50_V	0.513	0.13
44_D	69_K	0.512	0.13
84_H	95_D	0.509	0.13
33_L	63_K	0.508	0.13
46_D	86_L	0.502	0.13
65_R	78_A	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xn9A	1	0.9902	100	0.157	Contact Map
1ywxA	1	1	100	0.158	Contact Map
2v94A	1	0.9118	100	0.182	Contact Map
2g1dA	1	0.951	100	0.185	Contact Map
4ujpZ	1	1	100	0.236	Contact Map
4bpeP	1	0.9902	100	0.24	Contact Map
3j7a1	1	1	100	0.244	Contact Map
3j60Y	1	1	100	0.246	Contact Map
3zeyT	1	1	100	0.251	Contact Map
4w23Y	1	1	100	0.259	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.