Q9HNL1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNL1 - DNA-directed RNA polymerase subunit E

UniProt:	Q9HNL1	Sequences: MYKRARLKDTIEVPPEYLGAVGPDLVKRLLQDKLEGRMDEDVGSIVTVTEVHDLGEGAVLPNRPGVYYEAEFDAVTFEPEMQEVVDGEVVEVVSFGAFVGIGPVDGLLHVSQISDEYLAFDEENQQLASRESNQVLGTGDSVRARIVTKSIDERNPRESKIGLTAKQPGLGKHGWLQADREQADAASEGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	190 (154)
Sequences:	2576 (1498)
Seq/√Len:	120.7

ECOLI - PNP
BACSU - PNP RS1H
HALSA - Q9HNL1
SULSO - Q980A3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_R	9_D	4.943	1.00
86_D	143_R	3.907	1.00
30_L	38_M	3.229	1.00
88_E	141_S	3.222	1.00
113_I	136_L	3.109	1.00
41_D	44_S	2.843	1.00
86_D	141_S	2.758	1.00
70_A	74_A	2.592	1.00
90_V	100_G	2.380	1.00
146_I	161_I	2.312	1.00
112_Q	167_Q	2.289	1.00
64_P	68_Y	2.239	1.00
26_V	67_Y	2.147	1.00
13_V	16_E	2.079	1.00
106_G	163_L	2.068	1.00
90_V	105_D	2.055	1.00
108_L	113_I	2.043	1.00
80_E	83_E	2.022	1.00
29_L	56_E	2.006	1.00
142_V	165_A	2.005	1.00
137_G	140_D	1.906	1.00
8_K	12_E	1.898	1.00
2_Y	6_R	1.844	1.00
99_V	108_L	1.750	1.00
94_S	122_E	1.746	1.00
6_R	10_T	1.709	1.00
164_T	167_Q	1.644	1.00
77_F	83_E	1.643	1.00
79_P	146_I	1.625	1.00
55_G	61_P	1.598	1.00
100_G	105_D	1.562	1.00
148_T	162_G	1.559	1.00
70_A	73_D	1.527	1.00
52_H	56_E	1.521	1.00
5_A	9_D	1.468	1.00
65_G	68_Y	1.465	1.00
37_R	75_V	1.465	1.00
101_I	161_I	1.418	1.00
150_S	160_K	1.396	1.00
114_S	165_A	1.391	1.00
79_P	101_I	1.360	1.00
87_G	99_V	1.345	1.00
110_V	121_D	1.342	1.00
50_E	55_G	1.325	1.00
71_E	74_A	1.301	1.00
2_Y	5_A	1.284	1.00
41_D	45_I	1.280	1.00
113_I	118_L	1.264	1.00
108_L	165_A	1.263	1.00
63_R	66_V	1.256	0.99
120_F	134_Q	1.254	0.99
50_E	53_D	1.232	0.99
92_V	138_T	1.202	0.99
108_L	136_L	1.194	0.99
115_D	172_K	1.192	0.99
34_L	78_E	1.181	0.99
11_I	15_P	1.178	0.99
51_V	55_G	1.175	0.99
93_V	98_F	1.168	0.99
64_P	67_Y	1.152	0.99
170_L	173_H	1.127	0.99
92_V	121_D	1.110	0.99
5_A	8_K	1.105	0.99
113_I	135_V	1.072	0.98
65_G	69_E	1.065	0.98
38_M	41_D	1.053	0.98
55_G	60_L	1.049	0.98
28_R	59_V	1.043	0.98
121_D	134_Q	1.040	0.98
81_M	148_T	1.038	0.98
112_Q	166_K	1.031	0.98
87_G	163_L	1.025	0.98
89_V	136_L	0.999	0.97
24_D	61_P	0.998	0.97
113_I	121_D	0.998	0.97
61_P	67_Y	0.996	0.97
95_F	107_L	0.992	0.97
2_Y	9_D	0.986	0.97
95_F	98_F	0.969	0.97
45_I	75_V	0.954	0.97
115_D	173_H	0.944	0.96
62_N	67_Y	0.911	0.96
17_Y	64_P	0.909	0.95
149_K	161_I	0.907	0.95
97_A	136_L	0.897	0.95
140_D	165_A	0.894	0.95
61_P	66_V	0.883	0.95
136_L	142_V	0.879	0.95
50_E	60_L	0.877	0.95
84_V	145_R	0.874	0.94
91_E	138_T	0.869	0.94
34_L	37_R	0.865	0.94
152_D	160_K	0.852	0.94
101_I	146_I	0.846	0.93
91_E	160_K	0.844	0.93
87_G	106_G	0.844	0.93
115_D	170_L	0.835	0.93
50_E	61_P	0.833	0.93
100_G	103_P	0.832	0.93
54_L	61_P	0.830	0.93
112_Q	147_V	0.829	0.93
27_K	56_E	0.824	0.92
51_V	54_L	0.818	0.92
63_R	67_Y	0.815	0.92
33_K	36_G	0.814	0.92
84_V	143_R	0.807	0.92
110_V	120_F	0.798	0.91
118_L	134_Q	0.795	0.91
45_I	48_V	0.791	0.91
1_M	8_K	0.790	0.91
147_V	162_G	0.790	0.91
63_R	68_Y	0.788	0.91
88_E	100_G	0.785	0.91
25_L	60_L	0.783	0.90
4_R	8_K	0.782	0.90
118_L	121_D	0.777	0.90
53_D	61_P	0.775	0.90
38_M	45_I	0.774	0.90
51_V	60_L	0.770	0.90
37_R	45_I	0.770	0.90
93_V	138_T	0.767	0.90
1_M	4_R	0.762	0.89
147_V	164_T	0.751	0.89
25_L	58_A	0.743	0.88
38_M	57_G	0.743	0.88
114_S	118_L	0.741	0.88
113_I	165_A	0.741	0.88
53_D	60_L	0.734	0.87
145_R	167_Q	0.725	0.87
19_G	22_G	0.718	0.86
115_D	171_G	0.715	0.86
99_V	142_V	0.713	0.86
36_G	41_D	0.710	0.86
108_L	142_V	0.709	0.86
53_D	57_G	0.706	0.85
167_Q	170_L	0.706	0.85
116_E	119_A	0.706	0.85
92_V	136_L	0.703	0.85
66_V	69_E	0.686	0.84
143_R	165_A	0.680	0.83
52_H	58_A	0.677	0.83
35_E	51_V	0.676	0.83
36_G	42_V	0.675	0.83
48_V	71_E	0.673	0.82
50_E	54_L	0.670	0.82
91_E	98_F	0.670	0.82
116_E	135_V	0.666	0.82
112_Q	164_T	0.665	0.82
50_E	58_A	0.662	0.81
95_F	105_D	0.662	0.81
94_S	148_T	0.658	0.81
108_L	163_L	0.657	0.81
98_F	150_S	0.655	0.81
91_E	162_G	0.654	0.81
167_Q	171_G	0.653	0.81
63_R	69_E	0.652	0.80
85_V	144_A	0.651	0.80
101_I	104_V	0.650	0.80
14_P	18_L	0.650	0.80
145_R	166_K	0.650	0.80
62_N	68_Y	0.638	0.79
122_E	137_G	0.637	0.79
96_G	107_L	0.637	0.79
50_E	57_G	0.637	0.79
23_P	43_G	0.635	0.79
74_A	77_F	0.635	0.79
77_F	101_I	0.633	0.78
43_G	46_V	0.624	0.77
28_R	76_T	0.621	0.77
118_L	136_L	0.620	0.77
55_G	63_R	0.618	0.77
87_G	105_D	0.618	0.77
98_F	107_L	0.617	0.77
18_L	24_D	0.616	0.77
114_S	135_V	0.615	0.76
112_Q	148_T	0.613	0.76
39_D	43_G	0.611	0.76
148_T	151_I	0.610	0.76
107_L	111_S	0.609	0.76
112_Q	162_G	0.606	0.75
79_P	104_V	0.605	0.75
54_L	58_A	0.601	0.75
40_E	43_G	0.596	0.74
80_E	85_V	0.595	0.74
55_G	68_Y	0.593	0.74
73_D	77_F	0.581	0.72
122_E	138_T	0.577	0.72
31_Q	78_E	0.572	0.71
146_I	163_L	0.571	0.71
26_V	68_Y	0.567	0.70
23_P	39_D	0.567	0.70
97_A	121_D	0.562	0.70
30_L	35_E	0.559	0.69
18_L	22_G	0.559	0.69
12_E	16_E	0.554	0.69
118_L	135_V	0.553	0.69
1_M	135_V	0.551	0.68
11_I	14_P	0.549	0.68
68_Y	73_D	0.545	0.67
152_D	159_S	0.545	0.67
93_V	107_L	0.544	0.67
90_V	98_F	0.542	0.67
68_Y	74_A	0.541	0.67
81_M	147_V	0.541	0.67
49_T	71_E	0.537	0.66
29_L	54_L	0.536	0.66
49_T	69_E	0.536	0.66
23_P	40_E	0.534	0.66
97_A	108_L	0.533	0.66
97_A	134_Q	0.532	0.66
77_F	85_V	0.530	0.65
84_V	166_K	0.527	0.65
51_V	61_P	0.526	0.65
98_F	109_H	0.524	0.64
136_L	165_A	0.523	0.64
1_M	5_A	0.521	0.64
35_E	46_V	0.520	0.64
40_E	46_V	0.518	0.64
24_D	66_V	0.516	0.63
146_I	149_K	0.516	0.63
83_E	143_R	0.513	0.63
92_V	95_F	0.512	0.63
7_L	47_T	0.509	0.62
108_L	144_A	0.509	0.62
1_M	172_K	0.508	0.62
57_G	61_P	0.508	0.62
26_V	59_V	0.508	0.62
11_I	89_V	0.506	0.62
93_V	162_G	0.506	0.62
57_G	72_F	0.505	0.62
17_Y	24_D	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cdiA	3	0.0632	99.9	0.365	Contact Map
4nbqA	3	0.7316	99.9	0.387	Contact Map
4aidA	3	0.1895	99.9	0.39	Contact Map
1e3pA	3	0.4263	99.9	0.439	Contact Map
2b8kG	1	0.8737	99.9	0.453	Contact Map
3h0gG	1	0.8789	99.9	0.457	Contact Map
1go3E	1	0.9421	99.9	0.46	Contact Map
1y14B	2	0.8368	99.8	0.478	Contact Map
2c35B	1	0.8789	99.8	0.487	Contact Map
4qjfA	1	0.9789	99.8	0.493	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.