Q9HNL0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNL0 - Uncharacterized protein

UniProt:	Q9HNL0	Sequences: MQAVAIDTNALLLPATQPLRLFEELDRLLGDYDAVVPQAVHDELVALAAGAGETASAASVGVDLATDRCGTLRTDVSYADDALHALAVSEDVDAVVTNDGPLKERVLDAGTPVIHLRGRTQLTITRP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (119)
Sequences:	132 (105)
Seq/√Len:	9.6

HALSA - Q9HNL0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_D	70_G	4.699	1.00
24_E	27_R	3.403	0.96
5_A	83_L	3.144	0.94
22_F	69_C	3.057	0.93
95_V	106_V	2.946	0.91
83_L	95_V	2.680	0.87
83_L	106_V	2.338	0.78
13_L	21_L	2.230	0.74
42_D	45_V	2.137	0.71
6_I	83_L	2.111	0.70
52_G	57_A	2.098	0.69
23_E	28_L	2.042	0.67
37_P	105_R	2.027	0.67
45_V	67_D	1.955	0.64
21_L	51_A	1.853	0.59
17_Q	20_R	1.745	0.55
29_L	32_Y	1.745	0.55
25_L	52_G	1.710	0.53
16_T	20_R	1.684	0.52
37_P	86_L	1.659	0.51
13_L	17_Q	1.559	0.46
10_A	96_V	1.554	0.46
79_A	86_L	1.489	0.43
50_G	55_A	1.470	0.42
56_S	92_V	1.438	0.41
23_E	47_L	1.432	0.41
16_T	54_T	1.422	0.40
9_N	83_L	1.420	0.40
72_L	115_H	1.399	0.39
62_V	91_D	1.351	0.37
81_D	105_R	1.350	0.37
17_Q	119_R	1.348	0.37
38_Q	73_R	1.319	0.36
40_V	69_C	1.313	0.36
106_V	114_I	1.292	0.35
104_E	110_G	1.287	0.34
41_H	71_T	1.240	0.33
100_G	103_K	1.193	0.31
5_A	106_V	1.184	0.30
57_A	117_R	1.182	0.30
30_G	96_V	1.177	0.30
7_D	11_L	1.158	0.29
13_L	98_N	1.152	0.29
102_L	105_R	1.091	0.27
57_A	68_R	1.084	0.27
19_L	116_L	1.082	0.27
16_T	118_G	1.066	0.26
33_D	108_D	1.065	0.26
40_V	72_L	1.065	0.26
25_L	73_R	1.064	0.26
25_L	37_P	1.042	0.25
35_V	91_D	1.034	0.25
38_Q	41_H	1.031	0.25
110_G	115_H	1.024	0.25
4_V	84_H	1.023	0.25
13_L	16_T	1.016	0.24
112_P	116_L	1.008	0.24
47_L	79_A	1.004	0.24
19_L	57_A	0.996	0.24
5_A	95_V	0.995	0.24
28_L	105_R	0.993	0.24
34_A	114_I	0.988	0.24
19_L	119_R	0.966	0.23
46_A	78_Y	0.956	0.22
41_H	65_A	0.955	0.22
13_L	110_G	0.942	0.22
27_R	57_A	0.934	0.22
9_N	98_N	0.933	0.22
37_P	82_A	0.932	0.22
11_L	85_A	0.920	0.21
111_T	115_H	0.916	0.21
22_F	60_V	0.904	0.21
24_E	52_G	0.902	0.21
10_A	60_V	0.893	0.21
18_P	72_L	0.890	0.20
12_L	16_T	0.887	0.20
79_A	82_A	0.883	0.20
16_T	75_D	0.874	0.20
19_L	52_G	0.869	0.20
115_H	121_Q	0.868	0.20
13_L	103_K	0.859	0.20
114_I	122_L	0.851	0.19
19_L	117_R	0.849	0.19
41_H	100_G	0.830	0.19
87_A	95_V	0.828	0.19
30_G	77_S	0.815	0.18
51_A	89_S	0.812	0.18
34_A	59_S	0.810	0.18
38_Q	111_T	0.797	0.18
103_K	108_D	0.791	0.18
13_L	96_V	0.790	0.18
30_G	94_A	0.782	0.17
74_T	123_T	0.778	0.17
32_Y	115_H	0.773	0.17
107_L	115_H	0.755	0.17
27_R	78_Y	0.754	0.17
35_V	41_H	0.748	0.17
67_D	112_P	0.745	0.17
5_A	92_V	0.738	0.16
28_L	117_R	0.735	0.16
39_A	82_A	0.735	0.16
24_E	118_G	0.734	0.16
45_V	62_V	0.722	0.16
6_I	100_G	0.719	0.16
4_V	115_H	0.719	0.16
73_R	110_G	0.718	0.16
59_S	124_I	0.713	0.16
41_H	49_A	0.711	0.16
29_L	114_I	0.710	0.16
6_I	21_L	0.708	0.16
18_P	34_A	0.706	0.16
27_R	52_G	0.706	0.16
23_E	124_I	0.704	0.16
58_A	65_A	0.697	0.15
94_A	103_K	0.690	0.15
61_G	72_L	0.689	0.15
29_L	112_P	0.688	0.15
5_A	9_N	0.686	0.15
15_A	60_V	0.682	0.15
9_N	106_V	0.680	0.15
4_V	38_Q	0.679	0.15
36_V	112_P	0.675	0.15
22_F	40_V	0.674	0.15
25_L	41_H	0.673	0.15
62_V	118_G	0.672	0.15
5_A	94_A	0.670	0.15
67_D	123_T	0.668	0.15
72_L	87_A	0.667	0.15
104_E	112_P	0.655	0.14
15_A	121_Q	0.643	0.14
40_V	52_G	0.641	0.14
19_L	37_P	0.640	0.14
105_R	117_R	0.634	0.14
5_A	79_A	0.631	0.14
47_L	55_A	0.629	0.14
4_V	41_H	0.623	0.14
68_R	87_A	0.616	0.14
88_V	110_G	0.613	0.14
110_G	124_I	0.611	0.13
56_S	68_R	0.606	0.13
49_A	95_V	0.604	0.13
76_V	95_V	0.603	0.13
10_A	16_T	0.602	0.13
16_T	122_L	0.600	0.13
84_H	105_R	0.599	0.13
50_G	96_V	0.595	0.13
63_D	101_P	0.590	0.13
114_I	119_R	0.588	0.13
8_T	121_Q	0.587	0.13
45_V	48_A	0.583	0.13
15_A	47_L	0.581	0.13
47_L	56_S	0.579	0.13
14_P	113_V	0.578	0.13
13_L	109_A	0.558	0.12
21_L	116_L	0.555	0.12
41_H	70_G	0.553	0.12
21_L	100_G	0.549	0.12
13_L	122_L	0.548	0.12
83_L	96_V	0.543	0.12
43_E	97_T	0.542	0.12
43_E	80_D	0.542	0.12
43_E	99_D	0.542	0.12
80_D	99_D	0.542	0.12
80_D	97_T	0.542	0.12
25_L	96_V	0.539	0.12
20_R	63_D	0.539	0.12
27_R	60_V	0.534	0.12
55_A	81_D	0.532	0.12
10_A	58_A	0.531	0.12
4_V	7_D	0.528	0.12
47_L	78_Y	0.528	0.12
68_R	79_A	0.527	0.12
4_V	95_V	0.526	0.12
23_E	40_V	0.516	0.12
30_G	92_V	0.510	0.12
101_P	108_D	0.506	0.11
51_A	123_T	0.506	0.11
68_R	101_P	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mj7A	2	0.9449	99.9	0.495	Contact Map
1o4wA	2	0.9685	99.7	0.65	Contact Map
2dokA	2	0.8898	99.5	0.688	Contact Map
3i8oA	2	0.9055	99.4	0.706	Contact Map
3ix7A	2	0.937	99.4	0.709	Contact Map
2lcqA	1	0.8425	98.8	0.773	Contact Map
2hwyA	1	0.7717	98.8	0.776	Contact Map
3tndA	3	0.8661	97.9	0.826	Contact Map
4chgA	2	0.8583	97.9	0.828	Contact Map
3zvkA	3	0.8819	97.7	0.834	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.