TSR3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TSR3 - Probable ribosome biogenesis protein VNG_2075C

UniProt:	Q9HNJ6	Sequences: MELHVRYEGDDDPEKCTARKLARFDLAALHRTGRETPAGVVLNPHAERALSPADDTDMLVALDCSWETAGRAMFEIDGEHRALPFLVAANPVNYGQPFQLNTVEAFAGALAILGRWERAEELLSKFTWGHTFLELNEEPLRRYADCEDSSEVVAVQQAYLDAGED	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	165 (159)
Sequences:	502 (310)
Seq/√Len:	24.6

HALSA - TSR3
SULSO - TSR3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
55_D	58_M	6.736	1.00
17_T	101_N	3.892	1.00
103_V	123_L	3.420	1.00
15_K	92_V	2.940	1.00
61_A	102_T	2.894	1.00
147_E	151_E	2.827	0.99
68_T	71_R	2.805	0.99
89_A	135_L	2.801	0.99
50_L	109_A	2.410	0.98
130_H	134_E	2.331	0.98
3_L	110_L	2.117	0.96
93_N	99_Q	2.109	0.96
3_L	106_F	2.103	0.96
110_L	118_R	2.032	0.95
5_V	18_A	1.979	0.94
103_V	126_F	1.968	0.94
41_V	78_G	1.878	0.93
141_R	144_A	1.859	0.92
148_D	151_E	1.795	0.91
59_L	109_A	1.783	0.90
49_A	153_V	1.758	0.90
111_A	116_W	1.756	0.90
12_D	15_K	1.728	0.89
43_N	62_L	1.698	0.88
43_N	46_A	1.671	0.87
131_T	134_E	1.633	0.86
117_E	150_S	1.629	0.86
59_L	106_F	1.622	0.86
146_C	155_V	1.604	0.85
107_A	123_L	1.601	0.85
140_L	144_A	1.578	0.84
158_A	162_A	1.489	0.80
20_K	103_V	1.467	0.79
36_T	102_T	1.454	0.79
20_K	23_R	1.436	0.78
30_H	60_V	1.375	0.75
27_A	106_F	1.372	0.74
11_D	16_C	1.366	0.74
119_A	133_L	1.358	0.74
82_A	102_T	1.339	0.73
53_A	148_D	1.336	0.72
153_V	156_Q	1.332	0.72
85_F	98_F	1.327	0.72
49_A	156_Q	1.294	0.70
4_H	30_H	1.285	0.69
116_W	141_R	1.281	0.69
69_A	74_F	1.279	0.69
130_H	137_E	1.272	0.69
103_V	125_K	1.240	0.67
63_D	127_T	1.237	0.66
20_K	125_K	1.223	0.65
3_L	122_L	1.217	0.65
125_K	130_H	1.196	0.64
154_A	158_A	1.188	0.63
137_E	154_A	1.187	0.63
48_R	53_A	1.176	0.62
6_R	30_H	1.175	0.62
111_A	140_L	1.165	0.62
32_T	76_I	1.163	0.62
54_D	81_R	1.146	0.60
11_D	18_A	1.144	0.60
141_R	150_S	1.132	0.59
92_V	99_Q	1.131	0.59
60_V	102_T	1.130	0.59
59_L	142_R	1.127	0.59
6_R	11_D	1.125	0.59
40_V	152_V	1.088	0.56
116_W	144_A	1.085	0.56
137_E	159_Y	1.075	0.55
16_C	63_D	1.071	0.55
51_S	149_S	1.065	0.55
121_E	125_K	1.055	0.54
8_E	32_T	1.031	0.52
154_A	157_Q	1.027	0.52
91_P	128_W	1.021	0.51
142_R	159_Y	1.015	0.51
20_K	24_F	1.012	0.51
49_A	149_S	1.005	0.50
7_Y	18_A	1.000	0.50
10_D	68_T	0.995	0.50
58_M	113_L	0.993	0.49
16_C	64_C	0.981	0.49
11_D	102_T	0.980	0.49
42_L	63_D	0.976	0.48
87_V	96_Q	0.965	0.47
96_Q	120_E	0.953	0.47
69_A	73_M	0.952	0.47
113_L	122_L	0.948	0.46
19_R	63_D	0.941	0.46
96_Q	134_E	0.939	0.46
71_R	92_V	0.934	0.45
52_P	148_D	0.919	0.44
130_H	135_L	0.912	0.44
111_A	133_L	0.899	0.43
43_N	102_T	0.886	0.42
36_T	60_V	0.880	0.41
149_S	153_V	0.877	0.41
21_L	106_F	0.871	0.41
91_P	125_K	0.868	0.41
50_L	59_L	0.863	0.40
137_E	147_E	0.862	0.40
7_Y	146_C	0.857	0.40
5_V	11_D	0.855	0.40
4_H	62_L	0.853	0.40
24_F	125_K	0.853	0.40
27_A	102_T	0.853	0.40
53_A	101_N	0.847	0.39
5_V	27_A	0.846	0.39
13_P	52_P	0.840	0.39
86_L	112_I	0.834	0.38
153_V	157_Q	0.824	0.38
150_S	161_D	0.819	0.37
10_D	74_F	0.817	0.37
11_D	27_A	0.816	0.37
46_A	135_L	0.814	0.37
150_S	153_V	0.811	0.37
157_Q	161_D	0.809	0.37
137_E	141_R	0.805	0.36
126_F	129_G	0.802	0.36
107_A	128_W	0.802	0.36
85_F	97_P	0.796	0.36
150_S	156_Q	0.782	0.35
98_F	160_L	0.777	0.34
61_A	69_A	0.773	0.34
138_E	162_A	0.771	0.34
49_A	101_N	0.756	0.33
114_G	144_A	0.752	0.33
26_L	125_K	0.750	0.33
103_V	122_L	0.750	0.33
18_A	43_N	0.748	0.33
107_A	152_V	0.748	0.33
22_A	27_A	0.745	0.32
7_Y	11_D	0.743	0.32
41_V	94_Y	0.742	0.32
85_F	149_S	0.741	0.32
6_R	36_T	0.726	0.31
23_R	67_E	0.721	0.31
40_V	148_D	0.719	0.31
39_G	102_T	0.718	0.31
10_D	72_A	0.718	0.31
3_L	115_R	0.708	0.30
21_L	107_A	0.708	0.30
5_V	36_T	0.706	0.30
15_K	106_F	0.705	0.30
42_L	85_F	0.704	0.30
17_T	75_E	0.701	0.30
40_V	106_F	0.697	0.29
11_D	82_A	0.696	0.29
111_A	158_A	0.691	0.29
127_T	139_P	0.690	0.29
87_V	160_L	0.688	0.29
40_V	98_F	0.684	0.29
64_C	102_T	0.681	0.29
64_C	156_Q	0.680	0.28
64_C	69_A	0.680	0.28
18_A	102_T	0.679	0.28
49_A	82_A	0.678	0.28
88_A	129_G	0.673	0.28
38_A	77_D	0.671	0.28
123_L	151_E	0.663	0.27
17_T	128_W	0.661	0.27
79_E	101_N	0.660	0.27
3_L	128_W	0.657	0.27
21_L	129_G	0.645	0.26
93_N	152_V	0.645	0.26
41_V	157_Q	0.638	0.26
7_Y	62_L	0.631	0.26
59_L	110_L	0.626	0.25
72_A	101_N	0.626	0.25
50_L	113_L	0.622	0.25
92_V	139_P	0.621	0.25
44_P	63_D	0.620	0.25
51_S	152_V	0.615	0.25
76_I	79_E	0.611	0.25
63_D	153_V	0.609	0.25
50_L	106_F	0.609	0.25
89_A	123_L	0.605	0.24
150_S	158_A	0.604	0.24
106_F	109_A	0.603	0.24
134_E	137_E	0.601	0.24
31_R	91_P	0.600	0.24
6_R	10_D	0.600	0.24
40_V	159_Y	0.597	0.24
120_E	130_H	0.595	0.24
63_D	72_A	0.594	0.24
149_S	156_Q	0.593	0.24
16_C	44_P	0.591	0.24
133_L	137_E	0.591	0.24
103_V	129_G	0.588	0.23
82_A	94_Y	0.588	0.23
5_V	102_T	0.588	0.23
6_R	23_R	0.586	0.23
142_R	155_V	0.581	0.23
9_G	40_V	0.580	0.23
70_G	158_A	0.578	0.23
43_N	60_V	0.575	0.23
6_R	69_A	0.575	0.23
102_T	146_C	0.571	0.23
135_L	158_A	0.569	0.22
17_T	42_L	0.566	0.22
64_C	126_F	0.564	0.22
93_N	146_C	0.562	0.22
52_P	156_Q	0.554	0.22
146_C	152_V	0.552	0.22
86_L	123_L	0.551	0.22
25_D	68_T	0.548	0.21
11_D	60_V	0.546	0.21
97_P	156_Q	0.546	0.21
20_K	162_A	0.546	0.21
35_E	48_R	0.544	0.21
42_L	77_D	0.544	0.21
145_D	155_V	0.544	0.21
154_A	161_D	0.543	0.21
18_A	67_E	0.541	0.21
98_F	101_N	0.539	0.21
23_R	135_L	0.536	0.21
6_R	18_A	0.535	0.21
49_A	85_F	0.535	0.21
89_A	131_T	0.532	0.21
103_V	133_L	0.532	0.21
53_A	150_S	0.531	0.21
25_D	41_V	0.529	0.21
49_A	92_V	0.528	0.20
24_F	109_A	0.527	0.20
7_Y	16_C	0.526	0.20
3_L	41_V	0.525	0.20
42_L	59_L	0.522	0.20
38_A	75_E	0.521	0.20
26_L	103_V	0.519	0.20
8_E	36_T	0.519	0.20
26_L	35_E	0.515	0.20
113_L	133_L	0.513	0.20
141_R	145_D	0.508	0.20
13_P	19_R	0.508	0.20
22_A	35_E	0.507	0.19
9_G	127_T	0.507	0.19
86_L	108_G	0.501	0.19
116_W	120_E	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j16B	1	0.5879	24.6	0.959	Contact Map
1yrtA	1	0.5091	16.3	0.962	Contact Map
1mdaH	1	0.4364	9.5	0.966	Contact Map
1b6aA	1	0.3394	7.7	0.967	Contact Map
3zldB	1	0.1818	7	0.968	Contact Map
4jp6A	1	0.4121	5.7	0.969	Contact Map
4xglA	1	0.4121	5.7	0.969	Contact Map
1k32A	5	0.7394	5.3	0.97	Contact Map
2oizA	2	0.4545	5.3	0.97	Contact Map
3mbrX	1	0.3758	4.9	0.97	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.