Q9HNJ2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNJ2 - Uncharacterized protein

UniProt:	Q9HNJ2	Sequences: MSVRVVTSGAASFTCNAFLVVGDTTTLVDAGAYDGVADEIRAHVDALDQVVVTHQHTDHVQQLDAVVDAFDGPDVYAYADHPLRTHALADGDTVQVGDQAADVVFTPGHAPDHVSLVTETALFAGDVVVHDDGAFDDGSFGRTDMPGQSRERLIGSLRELLARMPDSVSEFYAGHGGVFEGDVRAVAERALDRAQRRDPKYPDDQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	205 (173)
Sequences:	15630 (10979)
Seq/√Len:	834.7

ECOLI - GLO2 YCBL
BACSU - PKSB YQGX YRKH YQJP YYBB YFLN YOBT
HALSA - Q9HNJ2 Q9HQ50 Q9HRG5 Q9HSD1 O54647 Q9HS22 Q9HNJ9 O54661 Q9HSH2
SULSO - Q7LYK3 Q97U88 Q97VU4 Q97UV2 Q97VU0 Q97YZ2 Q97UR2 Q97XZ1 Q97WC2 Q97Y13

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_T	48_D	4.189	1.00
106_T	115_S	4.057	1.00
52_V	63_L	3.057	1.00
93_T	100_A	2.996	1.00
101_A	118_T	2.746	1.00
95_Q	100_A	2.729	1.00
93_T	102_D	2.636	1.00
26_T	49_Q	2.485	1.00
103_V	114_V	2.457	1.00
37_A	69_A	2.416	1.00
102_D	119_E	2.391	1.00
51_V	116_L	2.303	1.00
118_T	121_A	2.179	1.00
24_T	46_A	2.140	1.00
25_T	45_D	2.095	1.00
39_E	43_H	1.987	1.00
49_Q	75_V	1.941	1.00
103_V	116_L	1.915	1.00
18_F	172_Y	1.898	1.00
21_V	45_D	1.868	1.00
78_Y	89_A	1.864	1.00
149_S	152_R	1.786	1.00
28_V	123_F	1.782	1.00
90_D	160_L	1.727	1.00
67_V	85_T	1.713	1.00
21_V	25_T	1.701	1.00
90_D	159_E	1.672	1.00
155_G	159_E	1.620	1.00
26_T	51_V	1.594	1.00
89_A	92_D	1.592	1.00
161_L	188_E	1.576	1.00
65_A	69_A	1.552	1.00
40_I	47_L	1.530	1.00
37_A	70_F	1.487	1.00
99_Q	118_T	1.482	1.00
39_E	42_A	1.481	1.00
115_S	122_L	1.481	1.00
37_A	41_R	1.476	1.00
102_D	117_V	1.448	1.00
64_D	68_D	1.393	1.00
77_A	105_F	1.386	1.00
33_Y	65_A	1.382	1.00
117_V	122_L	1.376	1.00
73_P	86_H	1.372	1.00
154_I	158_R	1.357	1.00
104_V	117_V	1.353	1.00
38_D	42_A	1.343	1.00
75_V	86_H	1.335	1.00
111_P	152_R	1.328	1.00
49_Q	73_P	1.293	1.00
28_V	53_T	1.287	1.00
159_E	162_A	1.273	1.00
110_A	113_H	1.266	1.00
158_R	191_L	1.264	1.00
47_L	72_G	1.229	1.00
86_H	92_D	1.223	1.00
64_D	67_V	1.215	1.00
106_T	156_S	1.210	1.00
74_D	77_A	1.210	1.00
47_L	70_F	1.203	1.00
34_D	38_D	1.163	1.00
104_V	160_L	1.149	1.00
80_D	112_D	1.146	1.00
171_F	179_F	1.137	1.00
90_D	105_F	1.128	1.00
152_R	155_G	1.127	1.00
18_F	123_F	1.122	1.00
63_L	74_D	1.121	1.00
150_R	154_I	1.117	1.00
122_L	164_M	1.104	1.00
181_G	185_A	1.097	1.00
25_T	47_L	1.088	1.00
41_R	69_A	1.087	1.00
75_V	88_L	1.086	1.00
117_V	168_V	1.077	1.00
38_D	41_R	1.070	1.00
150_R	153_L	1.067	1.00
27_L	47_L	1.065	1.00
113_H	125_G	1.053	1.00
91_G	102_D	1.049	1.00
108_G	156_S	1.042	1.00
36_V	39_E	1.035	1.00
170_E	178_V	1.033	1.00
158_R	162_A	1.022	1.00
135_F	141_G	1.020	1.00
115_S	127_V	1.013	1.00
33_Y	37_A	1.001	1.00
53_T	125_G	0.997	1.00
80_D	83_L	0.994	1.00
106_T	127_V	0.991	1.00
22_G	98_D	0.984	1.00
77_A	80_D	0.984	1.00
33_Y	62_Q	0.974	1.00
30_A	50_V	0.973	1.00
88_L	114_V	0.971	1.00
36_V	40_I	0.963	1.00
19_L	39_E	0.962	1.00
77_A	81_H	0.951	1.00
124_A	171_F	0.941	1.00
57_T	61_Q	0.940	1.00
65_A	68_D	0.940	1.00
51_V	101_A	0.934	1.00
127_V	160_L	0.929	1.00
78_Y	81_H	0.926	1.00
122_L	171_F	0.925	1.00
162_A	191_L	0.906	1.00
26_T	96_V	0.902	1.00
96_V	99_Q	0.901	1.00
79_A	89_A	0.900	1.00
188_E	191_L	0.896	1.00
95_Q	98_D	0.894	1.00
139_S	142_R	0.890	1.00
183_V	187_A	0.888	1.00
158_R	161_L	0.885	1.00
127_V	153_L	0.865	1.00
20_V	28_V	0.854	1.00
79_A	82_P	0.850	1.00
76_Y	86_H	0.848	1.00
22_G	97_G	0.844	1.00
113_H	127_V	0.838	1.00
151_E	155_G	0.836	1.00
145_M	150_R	0.836	1.00
63_L	67_V	0.834	1.00
99_Q	121_A	0.831	1.00
17_A	36_V	0.829	1.00
24_T	49_Q	0.828	1.00
117_V	164_M	0.824	1.00
81_H	87_A	0.823	1.00
78_Y	87_A	0.822	1.00
166_D	182_D	0.818	1.00
138_G	183_V	0.816	1.00
81_H	112_D	0.813	1.00
27_L	30_A	0.810	1.00
88_L	116_L	0.803	1.00
138_G	187_A	0.800	1.00
127_V	156_S	0.797	1.00
19_L	27_L	0.794	1.00
15_C	31_G	0.792	1.00
124_A	173_A	0.789	1.00
88_L	103_V	0.787	1.00
106_T	113_H	0.787	1.00
35_G	39_E	0.787	1.00
161_L	191_L	0.785	1.00
185_A	189_R	0.778	1.00
21_V	39_E	0.776	1.00
186_V	190_A	0.775	1.00
19_L	25_T	0.775	1.00
100_A	119_E	0.774	1.00
35_G	38_D	0.773	1.00
77_A	114_V	0.768	1.00
172_Y	178_V	0.768	1.00
105_F	114_V	0.767	1.00
137_D	177_G	0.767	1.00
26_T	101_A	0.766	1.00
142_R	145_M	0.758	1.00
50_V	72_G	0.756	1.00
13_F	57_T	0.754	1.00
138_G	182_D	0.742	1.00
111_P	147_G	0.739	1.00
101_A	116_L	0.738	1.00
93_T	119_E	0.735	1.00
25_T	48_D	0.729	1.00
88_L	92_D	0.726	1.00
50_V	63_L	0.721	1.00
49_Q	76_Y	0.718	1.00
135_F	142_R	0.718	1.00
15_C	174_G	0.713	1.00
102_D	164_M	0.710	1.00
104_V	115_S	0.709	1.00
76_Y	81_H	0.702	1.00
140_F	143_T	0.700	1.00
27_L	40_I	0.700	1.00
186_V	189_R	0.699	1.00
27_L	66_V	0.693	1.00
84_R	87_A	0.691	1.00
138_G	141_G	0.690	1.00
145_M	148_Q	0.684	1.00
62_Q	65_A	0.683	1.00
89_A	105_F	0.680	1.00
22_G	99_Q	0.680	1.00
30_A	63_L	0.678	1.00
49_Q	86_H	0.678	1.00
21_V	43_H	0.671	1.00
79_A	105_F	0.670	1.00
128_V	171_F	0.669	1.00
55_Q	112_D	0.666	1.00
123_F	172_Y	0.665	1.00
104_V	159_E	0.665	1.00
24_T	97_G	0.662	1.00
67_V	74_D	0.655	1.00
115_S	160_L	0.654	1.00
33_Y	36_V	0.654	1.00
165_P	168_V	0.653	1.00
185_A	188_E	0.653	1.00
9_G	14_T	0.648	1.00
126_D	175_H	0.644	1.00
73_P	85_T	0.639	1.00
76_Y	80_D	0.633	1.00
121_A	172_Y	0.631	1.00
71_D	74_D	0.625	1.00
171_F	181_G	0.622	1.00
88_L	94_V	0.622	1.00
28_V	51_V	0.617	1.00
166_D	185_A	0.616	1.00
34_D	65_A	0.615	1.00
155_G	158_R	0.605	1.00
60_V	63_L	0.603	1.00
16_N	176_G	0.599	1.00
66_V	70_F	0.594	1.00
25_T	40_I	0.594	1.00
11_A	17_A	0.593	1.00
52_V	60_V	0.590	1.00
146_P	149_S	0.590	1.00
34_D	37_A	0.588	1.00
117_V	166_D	0.588	1.00
50_V	66_V	0.586	1.00
104_V	122_L	0.584	1.00
11_A	14_T	0.582	1.00
121_A	170_E	0.577	1.00
18_F	174_G	0.575	1.00
25_T	46_A	0.575	1.00
74_D	86_H	0.575	1.00
135_F	140_F	0.568	1.00
96_V	101_A	0.567	1.00
137_D	178_V	0.566	1.00
20_V	26_T	0.564	1.00
94_V	97_G	0.561	1.00
135_F	138_G	0.560	1.00
10_A	15_C	0.559	1.00
30_A	62_Q	0.558	1.00
9_G	16_N	0.544	1.00
16_N	174_G	0.541	1.00
153_L	157_L	0.540	1.00
135_F	139_S	0.536	1.00
74_D	78_Y	0.532	1.00
55_Q	80_D	0.530	1.00
55_Q	76_Y	0.530	1.00
68_D	71_D	0.529	1.00
20_V	118_T	0.528	1.00
28_V	116_L	0.526	1.00
52_V	74_D	0.526	1.00
16_N	177_G	0.526	1.00
27_L	36_V	0.521	1.00
51_V	94_V	0.518	1.00
143_T	153_L	0.518	1.00
16_N	187_A	0.517	1.00
152_R	156_S	0.515	1.00
157_L	161_L	0.514	1.00
105_F	112_D	0.513	1.00
107_P	156_S	0.513	1.00
42_A	45_D	0.513	1.00
161_L	181_G	0.510	1.00
156_S	159_E	0.510	1.00
153_L	156_S	0.509	1.00
67_V	71_D	0.506	1.00
144_D	148_Q	0.506	1.00
74_D	81_H	0.505	1.00
33_Y	69_A	0.504	1.00
41_R	44_V	0.501	1.00
147_G	153_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qh5A	1	0.9317	100	0.283	Contact Map
4yslA	2	0.9561	100	0.295	Contact Map
3r2uA	4	0.9512	100	0.296	Contact Map
2qedA	1	0.9317	100	0.303	Contact Map
2gcuA	3	0.9561	100	0.304	Contact Map
4efzA	2	0.9512	100	0.306	Contact Map
3tp9A	2	0.9463	100	0.311	Contact Map
2p18A	1	0.9317	100	0.316	Contact Map
1xm8A	1	0.9317	100	0.319	Contact Map
2zo4A	1	0.9366	100	0.323	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.