HIS5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIS5 - Imidazole glycerol phosphate synthase subunit HisH

UniProt:	Q9HNI6	Sequences: MDTTGTGQRGASIVVVDYGLGNLRSVTRGLERASADVSIVGDPGALDDADGIVLPGVGAFGDGMENAGPFRDALTDAADEGRPLFGICLGMQMLLSSSEEADHEGQGDARGLDLIPGRNVRFTGTVKVPHMGWNELAVTRDHPLVGGVDGEYAYFVHSYYAAPDDPGHVVAETDYGERFPAVVANDAGNVFGTQFHPEKSGATGLRILRNFVDYCADQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	218 (193)
Sequences:	3863 (2523)
Seq/√Len:	181.6

ECOLI - HIS5
BACSU - HIS5
HALSA - HIS5
SULSO - HIS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
96_S	113_D	3.182	1.00
14_V	40_V	3.142	1.00
97_S	118_R	2.863	1.00
38_S	45_A	2.728	1.00
173_T	181_A	2.701	1.00
142_H	184_A	2.672	1.00
209_R	213_D	2.557	1.00
120_V	162_A	2.449	1.00
42_D	45_A	2.324	1.00
30_L	53_V	2.246	1.00
14_V	49_A	2.112	1.00
122_F	179_F	2.111	1.00
97_S	108_D	2.105	1.00
60_F	111_G	1.993	1.00
47_D	76_D	1.992	1.00
96_S	116_P	1.992	1.00
95_L	161_A	1.957	1.00
174_D	178_R	1.933	1.00
145_V	182_V	1.867	1.00
172_E	178_R	1.862	1.00
28_R	31_E	1.837	1.00
77_A	82_R	1.834	1.00
136_L	153_A	1.803	1.00
52_I	77_A	1.802	1.00
63_G	89_L	1.795	1.00
155_F	181_A	1.792	1.00
27_T	31_E	1.766	1.00
77_A	80_E	1.729	1.00
95_L	183_V	1.640	1.00
99_E	120_V	1.640	1.00
170_V	184_A	1.626	1.00
206_R	209_R	1.622	1.00
147_G	210_N	1.604	1.00
171_A	182_V	1.599	1.00
144_L	191_F	1.584	1.00
160_Y	177_E	1.571	1.00
151_E	203_T	1.555	1.00
101_A	107_G	1.553	1.00
119_N	161_A	1.531	1.00
15_V	27_T	1.518	1.00
153_A	203_T	1.516	1.00
169_V	180_P	1.514	1.00
126_V	176_G	1.488	1.00
35_A	212_V	1.486	1.00
78_A	114_L	1.469	1.00
148_V	151_E	1.458	1.00
182_V	193_T	1.453	1.00
71_R	75_T	1.450	1.00
75_T	114_L	1.444	1.00
13_I	212_V	1.425	1.00
30_L	35_A	1.390	1.00
122_F	160_Y	1.383	1.00
153_A	207_I	1.379	1.00
168_H	185_N	1.379	1.00
23_L	39_I	1.368	1.00
44_G	48_D	1.367	1.00
27_T	39_I	1.366	1.00
96_S	117_G	1.364	1.00
94_L	190_V	1.361	1.00
99_E	118_R	1.347	1.00
27_T	37_V	1.340	1.00
163_P	169_V	1.335	1.00
14_V	46_L	1.314	1.00
116_P	168_H	1.307	1.00
32_R	205_L	1.298	1.00
61_G	101_A	1.296	1.00
120_V	160_Y	1.294	1.00
87_I	208_L	1.286	1.00
40_V	45_A	1.283	1.00
15_V	30_L	1.282	1.00
136_L	171_A	1.262	1.00
97_S	110_R	1.258	1.00
61_G	107_G	1.258	1.00
130_H	179_F	1.253	1.00
143_P	184_A	1.252	1.00
115_I	168_H	1.232	1.00
91_M	192_G	1.213	1.00
46_L	73_A	1.212	1.00
61_G	109_A	1.208	1.00
193_T	207_I	1.207	1.00
123_T	177_E	1.206	1.00
206_R	210_N	1.205	1.00
31_E	36_D	1.201	1.00
73_A	77_A	1.197	1.00
135_E	150_G	1.187	1.00
146_G	213_D	1.178	1.00
147_G	206_R	1.155	1.00
137_A	178_R	1.130	1.00
68_G	71_R	1.130	1.00
76_D	80_E	1.128	1.00
99_E	108_D	1.126	1.00
94_L	114_L	1.114	1.00
139_T	172_E	1.113	1.00
40_V	49_A	1.110	1.00
44_G	47_D	1.088	1.00
14_V	52_I	1.070	1.00
165_D	168_H	1.067	1.00
18_Y	21_G	1.064	1.00
95_L	119_N	1.058	1.00
174_D	177_E	1.049	1.00
34_S	37_V	1.048	1.00
67_A	71_R	1.044	1.00
144_L	210_N	1.021	0.99
31_E	37_V	1.008	0.99
131_M	156_V	1.004	0.99
43_P	47_D	1.002	0.99
46_L	49_A	1.001	0.99
30_L	37_V	0.981	0.99
24_R	28_R	0.979	0.99
91_M	161_A	0.979	0.99
96_S	118_R	0.977	0.99
173_T	179_F	0.971	0.99
95_L	117_G	0.970	0.99
160_Y	180_P	0.966	0.99
137_A	150_G	0.962	0.99
135_E	152_Y	0.961	0.99
74_L	114_L	0.959	0.99
148_V	210_N	0.949	0.99
95_L	115_I	0.948	0.99
142_H	191_F	0.948	0.99
101_A	109_A	0.947	0.99
59_A	101_A	0.939	0.99
99_E	121_R	0.937	0.99
54_L	84_L	0.934	0.99
136_L	181_A	0.923	0.99
84_L	114_L	0.916	0.99
57_V	89_L	0.914	0.99
137_A	174_D	0.903	0.99
15_V	37_V	0.900	0.99
85_F	193_T	0.899	0.99
142_H	170_V	0.898	0.99
184_A	191_F	0.897	0.99
116_P	164_D	0.889	0.99
118_R	162_A	0.881	0.98
138_V	149_D	0.881	0.98
170_V	182_V	0.879	0.98
76_D	79_D	0.875	0.98
47_D	77_A	0.870	0.98
130_H	157_H	0.868	0.98
78_A	84_L	0.865	0.98
155_F	173_T	0.858	0.98
13_I	35_A	0.852	0.98
46_L	77_A	0.845	0.98
72_D	75_T	0.840	0.98
19_G	66_N	0.838	0.98
40_V	70_F	0.830	0.98
45_A	48_D	0.828	0.98
24_R	27_T	0.815	0.97
30_L	212_V	0.811	0.97
30_L	208_L	0.806	0.97
69_P	72_D	0.806	0.97
122_F	128_V	0.802	0.97
43_P	46_L	0.802	0.97
126_V	175_Y	0.797	0.97
60_F	93_M	0.794	0.97
51_G	211_F	0.794	0.97
162_A	177_E	0.784	0.97
96_S	115_I	0.781	0.97
141_D	146_G	0.779	0.97
63_G	93_M	0.776	0.97
33_A	212_V	0.772	0.97
13_I	51_G	0.771	0.97
64_M	109_A	0.771	0.97
125_T	176_G	0.769	0.96
115_I	183_V	0.763	0.96
72_D	76_D	0.757	0.96
43_P	73_A	0.755	0.96
57_V	91_M	0.755	0.96
171_A	181_A	0.754	0.96
75_T	79_D	0.749	0.96
137_A	172_E	0.749	0.96
64_M	71_R	0.748	0.96
110_R	113_D	0.742	0.96
16_V	54_L	0.742	0.96
84_L	94_L	0.740	0.96
29_G	33_A	0.739	0.96
46_L	70_F	0.732	0.95
17_D	41_G	0.730	0.95
163_P	180_P	0.722	0.95
67_A	70_F	0.714	0.95
146_G	206_R	0.704	0.94
14_V	45_A	0.703	0.94
130_H	134_N	0.701	0.94
136_L	207_I	0.697	0.94
40_V	73_A	0.697	0.94
114_L	190_V	0.694	0.94
130_H	173_T	0.693	0.94
52_I	73_A	0.689	0.94
43_P	72_D	0.686	0.93
61_G	65_E	0.685	0.93
60_F	109_A	0.685	0.93
116_P	185_N	0.685	0.93
136_L	151_E	0.682	0.93
52_I	74_L	0.680	0.93
51_G	83_P	0.676	0.93
14_V	38_S	0.672	0.93
116_P	165_D	0.667	0.92
101_A	108_D	0.661	0.92
84_L	190_V	0.660	0.92
139_T	178_R	0.656	0.92
40_V	46_L	0.656	0.92
30_L	33_A	0.655	0.92
33_A	205_L	0.654	0.92
81_G	189_N	0.653	0.92
16_V	52_I	0.648	0.91
138_V	171_A	0.645	0.91
59_A	109_A	0.644	0.91
131_M	152_Y	0.644	0.91
20_L	24_R	0.639	0.91
37_V	53_V	0.637	0.91
41_G	68_G	0.636	0.91
61_G	108_D	0.626	0.90
51_G	201_G	0.624	0.90
26_V	87_I	0.619	0.89
16_V	46_L	0.619	0.89
140_R	170_V	0.618	0.89
137_A	149_D	0.615	0.89
18_Y	63_G	0.607	0.88
183_V	192_G	0.607	0.88
24_R	179_F	0.606	0.88
140_R	167_G	0.605	0.88
16_V	74_L	0.605	0.88
28_R	205_L	0.599	0.88
151_E	206_R	0.594	0.87
15_V	39_I	0.591	0.87
63_G	66_N	0.590	0.87
96_S	164_D	0.588	0.87
43_P	69_P	0.588	0.87
170_V	191_F	0.587	0.87
23_L	127_K	0.586	0.87
143_P	146_G	0.585	0.87
98_S	122_F	0.582	0.86
67_A	74_L	0.582	0.86
117_G	161_A	0.580	0.86
33_A	208_L	0.578	0.86
144_L	207_I	0.577	0.86
26_V	29_G	0.575	0.86
59_A	62_D	0.574	0.86
20_L	23_L	0.571	0.85
164_D	167_G	0.570	0.85
85_F	211_F	0.567	0.85
52_I	80_E	0.566	0.85
152_Y	203_T	0.566	0.85
115_I	190_V	0.565	0.85
37_V	89_L	0.564	0.85
54_L	93_M	0.559	0.84
26_V	89_L	0.559	0.84
191_F	211_F	0.557	0.84
54_L	57_V	0.550	0.83
121_R	159_Y	0.548	0.83
20_L	63_G	0.546	0.83
99_E	123_T	0.545	0.83
19_G	119_N	0.544	0.82
89_L	93_M	0.542	0.82
145_V	171_A	0.542	0.82
134_N	175_Y	0.538	0.82
148_V	153_A	0.538	0.82
52_I	82_R	0.536	0.81
98_S	109_A	0.536	0.81
75_T	78_A	0.533	0.81
138_V	151_E	0.531	0.81
25_S	28_R	0.529	0.81
136_L	179_F	0.527	0.80
16_V	70_F	0.527	0.80
69_P	73_A	0.527	0.80
115_I	185_N	0.526	0.80
64_M	99_E	0.524	0.80
70_F	73_A	0.523	0.80
169_V	172_E	0.522	0.80
71_R	74_L	0.522	0.80
98_S	128_V	0.521	0.80
51_G	191_F	0.520	0.79
24_R	31_E	0.518	0.79
119_N	163_P	0.518	0.79
26_V	53_V	0.517	0.79
163_P	168_H	0.515	0.79
41_G	66_N	0.514	0.79
98_S	107_G	0.513	0.79
37_V	212_V	0.513	0.79
140_R	149_D	0.512	0.78
118_R	164_D	0.512	0.78
153_A	195_F	0.512	0.78
81_G	190_V	0.510	0.78
161_A	183_V	0.510	0.78
60_F	98_S	0.509	0.78
74_L	77_A	0.508	0.78
117_G	163_P	0.506	0.78
131_M	155_F	0.505	0.78
64_M	112_L	0.505	0.78
74_L	112_L	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jvnA	1	0.9266	100	0.464	Contact Map
4gudA	1	0.8945	100	0.514	Contact Map
1ka9H	1	0.8807	100	0.534	Contact Map
1gpwB	1	0.8761	100	0.547	Contact Map
3uowA	2	0.8853	100	0.554	Contact Map
2v4uA	1	0.8899	100	0.573	Contact Map
2w7tA	1	0.8899	100	0.593	Contact Map
2ywdA	1	0.8486	100	0.6	Contact Map
2issD	1	0.789	100	0.602	Contact Map
3d54D	1	0.867	100	0.606	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.