Q9HNH7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNH7 - Uncharacterized protein

UniProt:	Q9HNH7	Sequences: MKRPIETADAPAAVGAYSQAATDGDVVFTAGQIPMTPDGELIADEPIDVQTRQSLENVKAILEAEGLNMQDVLKVSVFMDDMDDFDAMNAAYKEYFQDNPPARSAVEVAALPKGVGVEIEAIAAQRD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (116)
Sequences:	6489 (4122)
Seq/√Len:	382.7

ECOLI - RIDA TDCF RUTC YJGH YOAB
BACSU - RIDA
HALSA - Q9HNH7
SULSO - Y3206

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_R	94_E	3.263	1.00
59_K	69_M	2.949	1.00
67_L	71_D	2.799	1.00
74_K	120_E	2.535	1.00
46_P	49_V	2.494	1.00
48_D	87_A	2.410	1.00
77_V	88_M	2.100	1.00
78_F	106_V	2.086	1.00
52_R	56_E	2.075	1.00
107_E	110_A	2.064	1.00
48_D	90_A	2.017	1.00
56_E	95_Y	1.928	1.00
58_V	121_A	1.910	1.00
33_I	115_V	1.836	1.00
62_L	123_A	1.800	1.00
50_Q	116_G	1.782	1.00
59_K	63_E	1.745	1.00
110_A	114_G	1.642	1.00
53_Q	57_N	1.621	1.00
42_I	115_V	1.618	1.00
75_V	121_A	1.617	1.00
84_D	116_G	1.598	1.00
52_R	95_Y	1.551	1.00
27_V	67_L	1.538	1.00
23_D	73_L	1.506	1.00
56_E	59_K	1.500	1.00
82_M	107_E	1.471	1.00
47_I	51_T	1.469	1.00
79_M	88_M	1.464	1.00
68_N	71_D	1.428	1.00
23_D	124_A	1.378	1.00
36_T	39_G	1.370	1.00
53_Q	56_E	1.363	1.00
79_M	105_A	1.347	1.00
34_P	115_V	1.344	1.00
22_T	25_D	1.338	1.00
28_F	122_I	1.324	1.00
104_S	120_E	1.315	1.00
31_G	118_E	1.256	1.00
72_V	121_A	1.233	1.00
41_L	113_K	1.221	1.00
89_N	103_R	1.206	1.00
87_A	90_A	1.206	1.00
36_T	43_A	1.198	1.00
80_D	84_D	1.187	1.00
91_A	94_E	1.156	1.00
29_T	61_I	1.147	1.00
22_T	27_V	1.147	1.00
62_L	67_L	1.133	1.00
27_V	65_E	1.121	1.00
84_D	87_A	1.109	1.00
92_Y	103_R	1.082	1.00
80_D	110_A	1.079	1.00
10_A	19_Q	1.077	1.00
9_D	63_E	1.070	1.00
78_F	108_V	1.067	1.00
26_V	124_A	1.066	1.00
34_P	54_S	1.062	1.00
52_R	91_A	1.055	1.00
76_S	120_E	1.050	1.00
22_T	67_L	1.048	1.00
29_T	121_A	1.033	1.00
97_Q	100_P	1.023	1.00
47_I	88_M	1.015	1.00
78_F	104_S	1.014	1.00
26_V	73_L	1.012	1.00
90_A	93_K	1.008	1.00
62_L	72_V	0.994	1.00
51_T	88_M	0.989	1.00
63_E	68_N	0.987	1.00
72_V	96_F	0.986	1.00
80_D	114_G	0.950	1.00
32_Q	61_I	0.950	1.00
83_D	110_A	0.947	1.00
90_A	94_E	0.920	1.00
20_A	61_I	0.920	1.00
81_D	84_D	0.906	1.00
80_D	116_G	0.906	1.00
44_D	49_V	0.902	1.00
59_K	95_Y	0.879	1.00
60_A	63_E	0.867	1.00
69_M	72_V	0.860	1.00
48_D	91_A	0.859	1.00
41_L	44_D	0.842	1.00
91_A	95_Y	0.830	1.00
80_D	109_A	0.826	1.00
55_L	95_Y	0.816	1.00
34_P	50_Q	0.815	1.00
47_I	84_D	0.812	1.00
85_F	105_A	0.810	1.00
37_P	53_Q	0.805	1.00
55_L	119_I	0.798	1.00
48_D	52_R	0.795	1.00
75_V	96_F	0.794	1.00
75_V	92_Y	0.787	1.00
80_D	108_V	0.782	1.00
93_K	100_P	0.774	1.00
70_Q	97_Q	0.772	1.00
55_L	69_M	0.763	1.00
69_M	95_Y	0.740	1.00
35_M	40_E	0.735	1.00
47_I	91_A	0.733	1.00
46_P	116_G	0.725	1.00
43_A	53_Q	0.722	1.00
89_N	92_Y	0.712	1.00
72_V	123_A	0.712	1.00
51_T	117_V	0.710	1.00
47_I	117_V	0.704	1.00
25_D	124_A	0.700	0.99
45_E	50_Q	0.692	0.99
9_D	60_A	0.690	0.99
78_F	120_E	0.688	0.99
14_V	113_K	0.687	0.99
36_T	41_L	0.686	0.99
55_L	92_Y	0.684	0.99
16_A	89_N	0.674	0.99
77_V	119_I	0.674	0.99
20_A	27_V	0.673	0.99
29_T	58_V	0.671	0.99
67_L	124_A	0.669	0.99
19_Q	61_I	0.669	0.99
20_A	65_E	0.660	0.99
45_E	49_V	0.657	0.99
49_V	52_R	0.651	0.99
27_V	123_A	0.650	0.99
76_S	104_S	0.649	0.99
54_S	119_I	0.647	0.99
48_D	94_E	0.647	0.99
79_M	82_M	0.639	0.99
82_M	110_A	0.619	0.99
37_P	60_A	0.618	0.99
56_E	60_A	0.607	0.99
86_D	90_A	0.604	0.99
39_G	43_A	0.604	0.99
47_I	87_A	0.602	0.98
43_A	49_V	0.600	0.98
74_K	104_S	0.595	0.98
85_F	112_P	0.592	0.98
44_D	50_Q	0.592	0.98
19_Q	64_A	0.589	0.98
33_I	113_K	0.584	0.98
21_A	73_L	0.584	0.98
43_A	46_P	0.583	0.98
81_D	116_G	0.579	0.98
23_D	28_F	0.576	0.98
46_P	87_A	0.575	0.98
46_P	50_Q	0.572	0.98
62_L	121_A	0.572	0.98
61_I	64_A	0.567	0.98
30_A	102_A	0.561	0.98
72_V	75_V	0.561	0.98
62_L	69_M	0.557	0.98
44_D	116_G	0.555	0.97
89_N	93_K	0.555	0.97
77_V	103_R	0.555	0.97
24_G	124_A	0.553	0.97
33_I	54_S	0.546	0.97
17_Y	31_G	0.543	0.97
70_Q	98_D	0.542	0.97
32_Q	58_V	0.540	0.97
67_L	123_A	0.537	0.97
34_P	42_I	0.537	0.97
80_D	107_E	0.529	0.97
79_M	84_D	0.525	0.96
23_D	26_V	0.524	0.96
18_S	21_A	0.524	0.96
26_V	122_I	0.521	0.96
54_S	117_V	0.519	0.96
53_Q	60_A	0.512	0.96
36_T	40_E	0.510	0.96
32_Q	57_N	0.506	0.96
9_D	38_D	0.505	0.96
81_D	107_E	0.501	0.95
21_A	102_A	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2b33A	3	0.9921	100	0.119	Contact Map
2dyyA	3	0.9921	100	0.132	Contact Map
1xrgA	3	0.9843	100	0.134	Contact Map
1qahA	3	1	100	0.141	Contact Map
3vczA	5	0.9685	100	0.148	Contact Map
3l7qA	3	0.9764	100	0.148	Contact Map
3r0pA	5	0.9843	100	0.149	Contact Map
1x25A	3	0.9921	100	0.151	Contact Map
3m1xA	3	0.9764	100	0.152	Contact Map
3k0tA	3	0.9764	100	0.154	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.