Q9HNG5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNG5 - Uncharacterized protein

UniProt:	Q9HNG5	Sequences: MSLELYKLPGCPYCAKVETKLDELGLDYVEHEVPSSHSDRDAVESVSGQTGVPVLVDPDHDIDGMPESDDIVAHLEQHYAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	81 (77)
Sequences:	412 (222)
Seq/√Len:	25.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_L	55_L	3.950	1.00
20_K	76_E	3.848	1.00
4_E	31_H	2.868	1.00
47_S	66_P	2.533	0.99
7_K	34_P	2.420	0.99
16_K	69_D	2.418	0.99
43_V	54_V	2.269	0.98
74_H	78_H	2.204	0.97
7_K	30_E	2.126	0.97
62_I	65_M	1.903	0.94
21_L	28_Y	1.819	0.92
4_E	58_P	1.712	0.89
13_Y	67_E	1.655	0.88
70_D	73_A	1.520	0.83
46_V	64_G	1.493	0.82
7_K	14_C	1.416	0.78
54_V	64_G	1.408	0.77
14_C	32_E	1.405	0.77
40_R	67_E	1.365	0.75
4_E	56_V	1.311	0.72
13_Y	40_R	1.229	0.67
27_D	37_H	1.192	0.65
41_D	52_V	1.173	0.63
69_D	77_Q	1.162	0.63
9_P	32_E	1.149	0.62
41_D	45_S	1.145	0.62
40_R	68_S	1.135	0.61
4_E	42_A	1.128	0.60
41_D	72_V	1.117	0.60
13_Y	68_S	1.113	0.59
30_E	34_P	1.108	0.59
36_S	39_D	1.094	0.58
12_P	33_V	1.071	0.56
50_T	66_P	1.049	0.55
6_Y	14_C	1.037	0.54
11_C	66_P	1.037	0.54
57_D	79_Y	1.036	0.54
15_A	19_T	1.025	0.53
61_D	73_A	0.995	0.51
8_L	11_C	0.988	0.50
42_A	46_V	0.987	0.50
20_K	72_V	0.981	0.50
25_G	32_E	0.967	0.49
6_Y	34_P	0.959	0.48
21_L	30_E	0.953	0.48
10_G	31_H	0.928	0.46
6_Y	50_T	0.900	0.44
34_P	37_H	0.893	0.43
3_L	29_V	0.890	0.43
16_K	23_E	0.882	0.43
62_I	77_Q	0.877	0.42
56_V	61_D	0.876	0.42
10_G	49_Q	0.868	0.42
5_L	55_L	0.849	0.40
15_A	35_S	0.846	0.40
17_V	65_M	0.821	0.38
11_C	14_C	0.819	0.38
46_V	56_V	0.818	0.38
43_V	47_S	0.810	0.38
35_S	40_R	0.800	0.37
42_A	45_S	0.776	0.35
7_K	32_E	0.770	0.35
20_K	45_S	0.769	0.35
35_S	59_D	0.760	0.34
8_L	35_S	0.756	0.34
39_D	50_T	0.755	0.34
49_Q	66_P	0.751	0.34
8_L	37_H	0.750	0.34
4_E	29_V	0.747	0.33
68_S	80_A	0.745	0.33
73_A	78_H	0.739	0.33
22_D	25_G	0.735	0.33
14_C	30_E	0.732	0.32
24_L	27_D	0.721	0.32
15_A	32_E	0.713	0.31
13_Y	33_V	0.700	0.30
41_D	46_V	0.689	0.30
6_Y	80_A	0.677	0.29
10_G	16_K	0.676	0.29
15_A	18_E	0.673	0.29
18_E	22_D	0.673	0.29
58_P	61_D	0.668	0.28
51_G	66_P	0.631	0.26
11_C	27_D	0.615	0.25
7_K	15_A	0.613	0.25
5_L	30_E	0.613	0.25
33_V	43_V	0.602	0.25
4_E	46_V	0.598	0.24
7_K	28_Y	0.592	0.24
19_T	32_E	0.589	0.24
56_V	73_A	0.577	0.23
6_Y	56_V	0.564	0.23
12_P	68_S	0.563	0.23
64_G	70_D	0.563	0.23
9_P	19_T	0.562	0.23
11_C	16_K	0.551	0.22
25_G	77_Q	0.548	0.22
51_G	54_V	0.544	0.22
40_R	65_M	0.540	0.21
33_V	52_V	0.536	0.21
9_P	15_A	0.533	0.21
5_L	21_L	0.529	0.21
29_V	43_V	0.528	0.21
13_Y	35_S	0.525	0.21
31_H	42_A	0.523	0.21
8_L	12_P	0.522	0.21
62_I	78_H	0.521	0.21
29_V	77_Q	0.519	0.20
6_Y	31_H	0.516	0.20
12_P	67_E	0.512	0.20
43_V	52_V	0.512	0.20
36_S	50_T	0.510	0.20
40_R	43_V	0.509	0.20
25_G	73_A	0.508	0.20
54_V	66_P	0.506	0.20
26_L	55_L	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kh7A	2	0.9877	99.4	0.57	Contact Map
3wywA	2	0.963	99.4	0.576	Contact Map
3nivA	2	0.7654	99.4	0.582	Contact Map
4mpgA	2	0.963	99.4	0.582	Contact Map
4igjA	2	0.9136	99.4	0.582	Contact Map
4ielA	2	0.963	99.3	0.583	Contact Map
3m0fA	2	0.9383	99.3	0.585	Contact Map
3touA	2	0.9506	99.3	0.586	Contact Map
1gnwA	2	0.9506	99.3	0.587	Contact Map
3vk9A	2	0.963	99.3	0.588	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.