Q9HNF5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNF5 - GTP cyclohydrolase II

UniProt:	Q9HNF5	Sequences: MRTDAGGLICVALGDAVADAFALPFIADELDHPAADHGHLGYDDRSSFSLTVNHRDTYTGITDDDRALTIAELGQAAADPAAVDFPATFRAPGHVHVLRAAPSLSARQGHTELGIALAGAAGVPPAVVVCEMLDADTGGARSVADAKRYASRHDIPYVEGSDLVAAFQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	168 (149)
Sequences:	3377 (1686)
Seq/√Len:	138.1

ECOLI - RIBB
BACSU - RIBBA
HALSA - Q9HNF5
SULSO - Q980B3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_V	20_A	3.983	1.00
134_D	145_D	3.593	1.00
108_Q	164_V	3.170	1.00
2_R	9_I	2.830	1.00
76_A	124_P	2.607	1.00
114_G	127_V	2.603	1.00
134_D	139_G	2.375	1.00
149_Y	153_H	2.338	1.00
11_V	73_L	2.319	1.00
15_D	102_P	2.211	1.00
18_A	99_R	2.199	1.00
2_R	133_L	2.154	1.00
78_A	89_F	2.146	1.00
19_D	99_R	2.138	1.00
8_L	61_I	2.049	1.00
101_A	106_A	2.042	1.00
70_I	95_V	2.038	1.00
68_L	72_E	2.012	1.00
13_L	18_A	1.956	1.00
72_E	89_F	1.950	1.00
103_S	106_A	1.926	1.00
147_K	151_S	1.923	1.00
147_K	157_Y	1.885	1.00
52_V	73_L	1.885	1.00
15_D	19_D	1.850	1.00
3_T	6_G	1.846	1.00
18_A	23_L	1.824	1.00
54_H	72_E	1.810	1.00
51_T	96_H	1.782	1.00
15_D	99_R	1.740	1.00
72_E	75_Q	1.700	1.00
100_A	115_I	1.678	1.00
79_D	87_A	1.666	1.00
8_L	96_H	1.522	1.00
16_A	102_P	1.511	1.00
117_L	158_V	1.491	1.00
143_V	157_Y	1.469	1.00
70_I	128_V	1.383	1.00
67_A	71_A	1.370	1.00
132_M	146_A	1.355	1.00
105_S	116_A	1.321	1.00
132_M	141_R	1.305	1.00
25_F	99_R	1.297	1.00
79_D	88_T	1.289	1.00
150_A	157_Y	1.288	1.00
54_H	57_T	1.266	1.00
68_L	71_A	1.263	1.00
55_R	90_R	1.257	1.00
134_D	141_R	1.247	1.00
3_T	136_D	1.209	1.00
104_L	116_A	1.204	1.00
74_G	126_A	1.192	1.00
14_G	125_P	1.189	1.00
145_D	148_R	1.173	0.99
11_V	70_I	1.164	0.99
58_Y	65_D	1.157	0.99
143_V	147_K	1.153	0.99
4_D	149_Y	1.127	0.99
9_I	130_C	1.127	0.99
56_D	68_L	1.105	0.99
102_P	106_A	1.090	0.99
22_A	91_A	1.084	0.99
114_G	129_V	1.082	0.99
18_A	25_F	1.076	0.99
4_D	152_R	1.070	0.99
13_L	126_A	1.063	0.99
17_V	124_P	1.035	0.99
12_A	129_V	1.015	0.99
13_L	73_L	1.014	0.98
12_A	115_I	1.004	0.98
57_T	65_D	1.001	0.98
118_A	126_A	0.996	0.98
113_L	160_G	0.995	0.98
4_D	136_D	0.984	0.98
72_E	78_A	0.977	0.98
11_V	95_V	0.973	0.98
11_V	52_V	0.959	0.98
33_P	90_R	0.954	0.98
143_V	159_E	0.942	0.98
120_A	163_L	0.933	0.97
64_D	139_G	0.933	0.97
6_G	133_L	0.929	0.97
32_H	90_R	0.923	0.97
118_A	123_V	0.922	0.97
108_Q	161_S	0.922	0.97
14_G	17_V	0.920	0.97
146_A	157_Y	0.918	0.97
54_H	89_F	0.905	0.97
2_R	6_G	0.886	0.96
148_R	151_S	0.874	0.96
53_N	89_F	0.870	0.96
150_A	155_I	0.870	0.96
32_H	44_D	0.870	0.96
5_A	149_Y	0.868	0.96
31_D	91_A	0.863	0.96
162_D	165_A	0.848	0.95
8_L	130_C	0.846	0.95
114_G	118_A	0.844	0.95
161_S	165_A	0.838	0.95
110_H	160_G	0.830	0.95
148_R	152_R	0.823	0.95
5_A	130_C	0.813	0.94
78_A	88_T	0.811	0.94
134_D	137_T	0.807	0.94
111_T	131_E	0.803	0.94
24_P	28_D	0.799	0.94
161_S	164_V	0.794	0.94
95_V	128_V	0.792	0.94
58_Y	142_S	0.791	0.93
33_P	44_D	0.787	0.93
23_L	73_L	0.776	0.93
8_L	48_F	0.775	0.93
25_F	47_S	0.773	0.93
144_A	147_K	0.771	0.93
11_V	74_G	0.769	0.92
75_Q	78_A	0.768	0.92
53_N	91_A	0.764	0.92
48_F	96_H	0.763	0.92
57_T	72_E	0.761	0.92
6_G	61_I	0.758	0.92
13_L	17_V	0.755	0.92
6_G	132_M	0.755	0.92
74_G	124_P	0.755	0.92
22_A	87_A	0.752	0.92
150_A	156_P	0.748	0.91
113_L	163_L	0.740	0.91
12_A	114_G	0.739	0.91
4_D	153_H	0.736	0.91
3_T	152_R	0.736	0.91
26_I	51_T	0.735	0.91
5_A	8_L	0.730	0.90
47_S	101_A	0.729	0.90
16_A	20_A	0.727	0.90
15_D	18_A	0.725	0.90
8_L	51_T	0.721	0.90
57_T	89_F	0.721	0.90
44_D	110_H	0.720	0.90
147_K	150_A	0.717	0.90
141_R	145_D	0.716	0.90
64_D	68_L	0.704	0.89
57_T	90_R	0.702	0.89
110_H	113_L	0.696	0.88
54_H	68_L	0.695	0.88
44_D	90_R	0.692	0.88
98_L	129_V	0.678	0.87
32_H	45_R	0.677	0.87
113_L	158_V	0.675	0.87
119_G	125_P	0.672	0.86
98_L	111_T	0.669	0.86
2_R	5_A	0.666	0.86
16_A	125_P	0.660	0.85
50_L	91_A	0.658	0.85
5_A	133_L	0.657	0.85
25_F	30_L	0.653	0.85
107_R	110_H	0.653	0.85
12_A	98_L	0.649	0.84
46_S	131_E	0.648	0.84
53_N	57_T	0.648	0.84
65_D	68_L	0.646	0.84
12_A	126_A	0.643	0.84
14_G	18_A	0.641	0.84
80_P	91_A	0.638	0.83
57_T	68_L	0.632	0.83
23_L	52_V	0.631	0.83
148_R	154_D	0.627	0.82
71_A	74_G	0.626	0.82
11_V	126_A	0.623	0.82
9_I	133_L	0.619	0.82
52_V	89_F	0.613	0.81
47_S	129_V	0.612	0.81
14_G	119_G	0.611	0.81
27_A	91_A	0.604	0.80
26_I	96_H	0.602	0.80
67_A	74_G	0.601	0.80
120_A	166_A	0.595	0.79
107_R	111_T	0.593	0.79
46_S	140_A	0.592	0.79
2_R	61_I	0.591	0.79
31_D	90_R	0.590	0.78
18_A	49_S	0.585	0.78
80_P	87_A	0.584	0.78
151_S	154_D	0.584	0.78
32_H	53_N	0.583	0.78
151_S	157_Y	0.580	0.77
118_A	124_P	0.572	0.76
134_D	152_R	0.570	0.76
20_A	124_P	0.570	0.76
1_M	5_A	0.561	0.75
72_E	88_T	0.561	0.75
2_R	132_M	0.559	0.75
22_A	80_P	0.556	0.74
2_R	8_L	0.555	0.74
14_G	102_P	0.550	0.73
143_V	150_A	0.544	0.73
134_D	138_G	0.542	0.72
131_E	140_A	0.541	0.72
23_L	45_R	0.539	0.72
46_S	111_T	0.535	0.71
137_T	142_S	0.531	0.71
143_V	161_S	0.531	0.71
98_L	110_H	0.530	0.71
110_H	114_G	0.528	0.70
61_I	140_A	0.525	0.70
106_A	164_V	0.524	0.70
144_A	148_R	0.523	0.70
56_D	90_R	0.522	0.70
26_I	49_S	0.522	0.70
10_C	48_F	0.521	0.69
110_H	131_E	0.521	0.69
22_A	79_D	0.518	0.69
55_R	88_T	0.518	0.69
103_S	108_Q	0.515	0.69
17_V	126_A	0.514	0.68
107_R	112_E	0.512	0.68
130_C	140_A	0.512	0.68
10_C	129_V	0.510	0.68
109_G	112_E	0.508	0.68
12_A	130_C	0.506	0.67
73_L	126_A	0.505	0.67
52_V	74_G	0.504	0.67
158_V	162_D	0.503	0.67
6_G	129_V	0.502	0.67
56_D	88_T	0.501	0.66
22_A	28_D	0.500	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1snnA	2	0.994	100	0.108	Contact Map
4ffjA	2	0.8571	100	0.134	Contact Map
1k4iA	2	0.9048	100	0.137	Contact Map
3mioA	2	0.8333	100	0.14	Contact Map
4p6dA	2	0.8393	100	0.141	Contact Map
1g57A	2	0.8988	100	0.142	Contact Map
1tksA	2	0.869	100	0.145	Contact Map
4i14A	2	0.8452	100	0.153	Contact Map
2jisA	2	0.9345	48.2	0.939	Contact Map
4ritB	2	0.9286	44.5	0.941	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.