Q9HND9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HND9 - H+-transporting ATP synthase subunit K

UniProt:	Q9HND9	Sequences: MPAITPKAAAALAVGLAALAAGYAERGIGSAAVGAIAEDPDLFGTGLILTVLPETLVILALVVVFVVPTPF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	71 (63)
Sequences:	1210 (614)
Seq/√Len:	77.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_A	60_A	4.882	1.00
11_A	15_G	3.327	1.00
14_V	64_V	2.995	1.00
25_E	54_E	2.684	1.00
56_L	59_L	2.212	1.00
20_A	24_A	1.808	1.00
62_V	65_F	1.780	1.00
32_A	50_T	1.732	1.00
42_L	45_T	1.544	0.99
12_L	15_G	1.542	0.99
22_G	26_R	1.527	0.99
7_K	10_A	1.473	0.99
13_A	64_V	1.416	0.99
51_V	55_T	1.376	0.99
39_D	42_L	1.331	0.98
58_I	62_V	1.311	0.98
9_A	20_A	1.262	0.97
8_A	12_L	1.237	0.97
53_P	56_L	1.213	0.97
55_T	62_V	1.207	0.97
29_G	50_T	1.168	0.96
35_A	46_G	1.145	0.96
12_L	16_L	1.134	0.95
35_A	42_L	1.114	0.95
18_A	62_V	1.106	0.95
18_A	57_V	1.096	0.94
26_R	30_S	1.083	0.94
25_E	29_G	1.081	0.94
50_T	54_E	1.049	0.93
11_A	22_G	1.038	0.93
9_A	13_A	1.031	0.92
14_V	66_V	1.019	0.92
23_Y	30_S	1.012	0.92
61_L	66_V	0.992	0.91
37_A	40_P	0.978	0.90
27_G	30_S	0.917	0.87
14_V	60_A	0.901	0.86
51_V	58_I	0.899	0.86
21_A	46_G	0.896	0.86
53_P	57_V	0.868	0.84
61_L	65_F	0.847	0.82
9_A	24_A	0.841	0.82
10_A	63_V	0.826	0.81
51_V	67_V	0.816	0.80
44_G	65_F	0.808	0.79
13_A	38_E	0.801	0.79
54_E	57_V	0.799	0.79
16_L	41_D	0.799	0.79
29_G	33_V	0.798	0.78
48_I	56_L	0.787	0.77
15_G	22_G	0.784	0.77
25_E	50_T	0.782	0.77
21_A	57_V	0.781	0.77
58_I	61_L	0.777	0.77
24_A	28_I	0.769	0.76
21_A	54_E	0.753	0.74
23_Y	27_G	0.749	0.74
33_V	54_E	0.732	0.72
39_D	52_L	0.719	0.71
34_G	39_D	0.711	0.70
13_A	63_V	0.689	0.68
36_I	62_V	0.676	0.66
9_A	31_A	0.675	0.66
38_E	61_L	0.665	0.65
19_L	22_G	0.657	0.64
34_G	37_A	0.655	0.64
22_G	54_E	0.652	0.63
9_A	53_P	0.644	0.62
20_A	59_L	0.640	0.62
30_S	57_V	0.634	0.61
24_A	53_P	0.626	0.60
23_Y	61_L	0.618	0.59
41_D	46_G	0.611	0.58
38_E	47_L	0.608	0.58
32_A	48_I	0.606	0.58
5_T	8_A	0.585	0.55
21_A	47_L	0.578	0.54
8_A	34_G	0.567	0.53
28_I	53_P	0.566	0.53
49_L	54_E	0.565	0.53
43_F	67_V	0.560	0.52
43_F	50_T	0.550	0.51
28_I	41_D	0.549	0.51
15_G	27_G	0.547	0.50
16_L	23_Y	0.547	0.50
11_A	52_L	0.536	0.49
46_G	50_T	0.534	0.49
32_A	57_V	0.526	0.48
30_S	50_T	0.521	0.47
27_G	35_A	0.515	0.46
15_G	19_L	0.511	0.46
18_A	25_E	0.511	0.46
22_G	30_S	0.505	0.45
24_A	59_L	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bl2A	3	1	99.5	0.247	Contact Map
3j9tY	3	0.9577	99.5	0.262	Contact Map
4cbkA	3	0.9155	99.3	0.345	Contact Map
4v1gA	3	1	99.3	0.346	Contact Map
1wu0A	1	0.9577	99.3	0.348	Contact Map
2xquA	3	1	99.3	0.355	Contact Map
4bemJ	1	0.9859	99.2	0.363	Contact Map
3zk1A	5	0.9859	99.2	0.365	Contact Map
1a91A	1	1	99.2	0.371	Contact Map
4f4sA	3	0.9718	99.2	0.373	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.