Q9HNC4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNC4 - Mannose-1-phosphate guanylyltransferase

UniProt:	Q9HNC4	Sequences: MLCLPSDHVVGDGFQETAETAVDVAARTDGLVTIGIEPDRPATGYGYIEPGDDHGDHSEVAVFREKPDAETASRLVDRGCLWNAGMFAWTPTAFLDAARSGPLDPLVDALATDADPATAFERVDPVSVDYAVLERAADVRVVPAAFDWDDLGAWNALGRLLDGENAVLGDATTIDATGNVLASDDKHVSVVGVDDLVVAAYDDRVLVVPRADAQRVRDVVAALDAPF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	227 (224)
Sequences:	3623 (2848)
Seq/√Len:	190.3

ECOLI - MANC
HALSA - Q9HNC4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
68_D	71_T	4.267	1.00
193_V	196_L	4.115	1.00
212_D	215_R	3.669	1.00
69_A	73_S	3.553	1.00
176_A	179_N	3.218	1.00
49_E	61_A	3.111	1.00
73_S	77_D	2.954	1.00
186_K	200_A	2.912	1.00
177_T	194_D	2.895	1.00
136_A	139_V	2.842	1.00
215_R	218_D	2.520	1.00
176_A	190_V	2.391	1.00
200_A	205_V	2.368	1.00
60_V	139_V	2.310	1.00
49_E	62_V	2.283	1.00
97_A	136_A	2.171	1.00
50_P	81_L	2.125	1.00
190_V	198_V	2.062	1.00
149_D	159_R	2.030	1.00
102_P	131_A	1.972	1.00
167_V	173_T	1.937	1.00
49_E	80_C	1.929	1.00
64_R	75_L	1.917	1.00
71_T	74_R	1.909	1.00
175_D	212_D	1.905	1.00
24_V	57_H	1.878	1.00
30_G	140_R	1.871	1.00
30_G	138_D	1.837	1.00
98_A	132_V	1.815	1.00
100_S	137_A	1.805	1.00
195_D	209_P	1.801	1.00
99_R	107_V	1.799	1.00
181_L	188_V	1.798	1.00
81_L	141_V	1.728	1.00
48_I	141_V	1.709	1.00
94_F	128_V	1.703	1.00
102_P	126_V	1.699	1.00
178_G	195_D	1.687	1.00
194_D	209_P	1.685	1.00
158_G	163_G	1.661	1.00
181_L	190_V	1.660	1.00
11_G	147_D	1.658	1.00
174_I	222_A	1.587	1.00
94_F	98_A	1.572	1.00
218_D	221_A	1.566	1.00
21_A	88_A	1.557	1.00
90_T	93_A	1.525	1.00
116_P	119_A	1.516	1.00
50_P	58_S	1.458	1.00
13_G	16_E	1.455	1.00
192_G	212_D	1.448	1.00
190_V	193_V	1.414	1.00
70_E	73_S	1.392	1.00
209_P	212_D	1.389	1.00
197_V	210_R	1.377	1.00
97_A	138_D	1.374	1.00
94_F	132_V	1.373	1.00
2_L	88_A	1.370	1.00
96_D	99_R	1.368	1.00
49_E	78_R	1.365	1.00
89_W	94_F	1.358	1.00
173_T	190_V	1.345	1.00
12_D	145_A	1.342	1.00
127_S	130_Y	1.337	1.00
74_R	78_R	1.335	1.00
173_T	181_L	1.315	1.00
52_D	59_E	1.303	1.00
155_N	213_A	1.286	1.00
172_T	187_H	1.283	1.00
174_I	218_D	1.282	1.00
119_A	122_R	1.276	1.00
75_L	80_C	1.265	1.00
186_K	205_V	1.247	1.00
36_I	84_A	1.242	1.00
103_L	107_V	1.224	1.00
155_N	159_R	1.219	1.00
178_G	194_D	1.204	1.00
20_T	56_D	1.203	1.00
25_A	32_V	1.201	1.00
110_L	113_D	1.193	1.00
196_L	209_P	1.189	1.00
30_G	59_E	1.182	1.00
151_L	160_L	1.181	1.00
51_G	59_E	1.180	1.00
93_A	138_D	1.177	1.00
179_N	182_A	1.168	1.00
173_T	176_A	1.164	1.00
31_L	93_A	1.143	1.00
48_I	60_V	1.125	1.00
184_D	200_A	1.125	1.00
13_G	17_T	1.123	1.00
191_V	219_V	1.113	1.00
195_D	211_A	1.109	1.00
71_T	75_L	1.107	1.00
198_V	207_V	1.094	1.00
4_L	86_M	1.083	1.00
102_P	135_R	1.081	1.00
201_Y	204_R	1.080	1.00
18_A	88_A	1.064	1.00
181_L	198_V	1.062	1.00
99_R	104_D	1.058	1.00
99_R	103_L	1.054	1.00
197_V	213_A	1.051	1.00
16_E	19_E	1.050	1.00
34_I	144_A	1.041	1.00
12_D	147_D	1.038	1.00
158_G	180_V	1.037	1.00
5_P	86_M	1.036	1.00
16_E	20_T	1.030	1.00
185_D	200_A	1.022	1.00
3_C	89_W	1.021	1.00
102_P	124_D	1.020	1.00
189_S	219_V	1.018	1.00
158_G	210_R	1.014	1.00
31_L	136_A	1.010	1.00
161_L	166_A	1.000	1.00
37_E	145_A	0.999	0.99
2_L	18_A	0.997	0.99
32_V	140_R	0.994	0.99
187_H	204_R	0.985	0.99
126_V	130_Y	0.982	0.99
172_T	222_A	0.982	0.99
176_A	181_L	0.952	0.99
23_D	27_R	0.947	0.99
92_T	96_D	0.946	0.99
64_R	71_T	0.938	0.99
112_T	116_P	0.930	0.99
51_G	58_S	0.927	0.99
97_A	100_S	0.927	0.99
96_D	100_S	0.920	0.99
221_A	225_A	0.913	0.99
93_A	96_D	0.911	0.99
15_Q	19_E	0.905	0.99
217_R	221_A	0.903	0.99
183_S	188_V	0.897	0.99
20_T	23_D	0.892	0.99
104_D	107_V	0.890	0.99
24_V	140_R	0.888	0.99
20_T	142_V	0.884	0.99
62_V	80_C	0.875	0.99
195_D	210_R	0.874	0.99
31_L	89_W	0.873	0.99
87_F	133_L	0.868	0.99
167_V	171_A	0.853	0.98
171_A	190_V	0.849	0.98
36_I	144_A	0.842	0.98
20_T	55_G	0.841	0.98
21_A	142_V	0.840	0.98
221_A	224_D	0.837	0.98
74_R	77_D	0.837	0.98
155_N	211_A	0.834	0.98
44_G	214_Q	0.832	0.98
104_D	108_D	0.831	0.98
165_N	168_L	0.828	0.98
179_N	196_L	0.828	0.98
24_V	28_T	0.826	0.98
49_E	64_R	0.824	0.98
222_A	225_A	0.823	0.98
168_L	182_A	0.822	0.98
107_V	111_A	0.822	0.98
105_P	119_A	0.815	0.98
21_A	32_V	0.811	0.98
103_L	106_L	0.810	0.98
51_G	61_A	0.810	0.98
176_A	193_V	0.808	0.98
103_L	109_A	0.802	0.98
105_P	118_T	0.797	0.98
174_I	219_V	0.796	0.97
188_V	205_V	0.795	0.97
191_V	216_V	0.794	0.97
102_P	132_V	0.788	0.97
33_T	133_L	0.778	0.97
197_V	208_V	0.776	0.97
165_N	169_G	0.776	0.97
112_T	115_D	0.774	0.97
167_V	181_L	0.772	0.97
190_V	196_L	0.771	0.97
158_G	166_A	0.771	0.97
14_F	18_A	0.770	0.97
111_A	115_D	0.767	0.97
175_D	192_G	0.766	0.97
2_L	34_I	0.765	0.97
17_T	146_F	0.764	0.97
163_G	166_A	0.758	0.97
96_D	138_D	0.757	0.97
1_M	91_P	0.756	0.97
13_G	145_A	0.756	0.97
42_A	214_Q	0.753	0.97
216_V	220_V	0.750	0.96
31_L	94_F	0.744	0.96
59_E	140_R	0.735	0.96
3_C	31_L	0.727	0.96
29_D	90_T	0.726	0.96
188_V	200_A	0.725	0.96
50_P	78_R	0.720	0.96
41_P	69_A	0.719	0.95
175_D	191_V	0.718	0.95
98_A	102_P	0.716	0.95
112_T	119_A	0.716	0.95
128_V	132_V	0.715	0.95
186_K	202_D	0.710	0.95
126_V	131_A	0.705	0.95
4_L	14_F	0.695	0.95
97_A	137_A	0.694	0.95
9_V	160_L	0.694	0.95
196_L	207_V	0.693	0.94
17_T	144_A	0.693	0.94
106_L	109_A	0.693	0.94
58_S	61_A	0.692	0.94
22_V	27_R	0.689	0.94
87_F	129_D	0.688	0.94
40_R	159_R	0.688	0.94
109_A	113_D	0.684	0.94
116_P	120_F	0.682	0.94
1_M	94_F	0.681	0.94
118_T	121_E	0.680	0.94
32_V	142_V	0.679	0.94
154_W	157_L	0.678	0.94
106_L	123_V	0.678	0.94
29_D	96_D	0.676	0.94
108_D	112_T	0.676	0.94
53_D	56_D	0.674	0.94
34_I	88_A	0.674	0.94
50_P	141_V	0.671	0.93
57_H	142_V	0.671	0.93
200_A	203_D	0.667	0.93
133_L	136_A	0.665	0.93
220_V	223_L	0.665	0.93
95_L	103_L	0.660	0.93
17_T	142_V	0.659	0.93
17_T	145_A	0.659	0.93
204_R	223_L	0.658	0.93
98_A	131_A	0.655	0.93
161_L	168_L	0.654	0.93
103_L	110_L	0.653	0.93
31_L	139_V	0.652	0.92
33_T	60_V	0.651	0.92
126_V	135_R	0.649	0.92
22_V	88_A	0.648	0.92
68_D	74_R	0.647	0.92
9_V	166_A	0.646	0.92
149_D	158_G	0.645	0.92
42_A	45_Y	0.642	0.92
52_D	61_A	0.640	0.92
154_W	182_A	0.640	0.92
198_V	205_V	0.636	0.92
23_D	28_T	0.630	0.91
175_D	215_R	0.626	0.91
188_V	198_V	0.622	0.91
19_E	22_V	0.622	0.91
4_L	8_H	0.621	0.91
64_R	80_C	0.619	0.90
161_L	180_V	0.616	0.90
97_A	101_G	0.614	0.90
133_L	139_V	0.613	0.90
192_G	215_R	0.613	0.90
12_D	16_E	0.611	0.90
33_T	87_F	0.611	0.90
117_A	121_E	0.609	0.90
22_V	25_A	0.606	0.90
125_P	221_A	0.604	0.89
81_L	143_P	0.602	0.89
19_E	23_D	0.600	0.89
15_Q	18_A	0.597	0.89
93_A	136_A	0.595	0.89
57_H	140_R	0.590	0.88
24_V	30_G	0.589	0.88
189_S	206_L	0.586	0.88
123_V	126_V	0.585	0.88
43_T	69_A	0.578	0.87
155_N	158_G	0.575	0.87
161_L	182_A	0.575	0.87
51_G	57_H	0.572	0.87
25_A	29_D	0.568	0.86
174_I	215_R	0.568	0.86
191_V	208_V	0.566	0.86
93_A	97_A	0.564	0.86
31_L	157_L	0.560	0.86
99_R	108_D	0.559	0.85
109_A	119_A	0.558	0.85
156_A	159_R	0.556	0.85
83_N	87_F	0.555	0.85
66_K	72_A	0.553	0.85
3_C	6_S	0.552	0.85
34_I	140_R	0.550	0.84
40_R	155_N	0.549	0.84
54_H	57_H	0.548	0.84
191_V	206_L	0.546	0.84
120_F	123_V	0.546	0.84
180_V	197_V	0.546	0.84
33_T	84_A	0.545	0.84
216_V	219_V	0.543	0.84
118_T	122_R	0.541	0.84
108_D	122_R	0.541	0.84
5_P	125_P	0.538	0.83
19_E	27_R	0.537	0.83
20_T	57_H	0.536	0.83
10_V	86_M	0.534	0.83
105_P	124_D	0.533	0.83
116_P	131_A	0.533	0.83
155_N	210_R	0.532	0.83
17_T	34_I	0.530	0.82
213_A	216_V	0.528	0.82
67_P	72_A	0.527	0.82
106_L	110_L	0.525	0.82
5_P	127_S	0.525	0.82
101_G	135_R	0.525	0.82
89_W	98_A	0.524	0.82
157_L	199_A	0.523	0.81
105_P	122_R	0.523	0.81
37_E	143_P	0.521	0.81
84_A	183_S	0.519	0.81
143_P	214_Q	0.519	0.81
83_N	129_D	0.519	0.81
98_A	128_V	0.518	0.81
178_G	210_R	0.518	0.81
31_L	97_A	0.517	0.81
182_A	200_A	0.517	0.81
169_G	205_V	0.516	0.81
191_V	209_P	0.514	0.80
33_T	141_V	0.513	0.80
97_A	139_V	0.513	0.80
11_G	151_L	0.513	0.80
43_T	214_Q	0.511	0.80
114_A	121_E	0.511	0.80
105_P	123_V	0.509	0.80
45_Y	127_S	0.508	0.80
12_D	146_F	0.508	0.80
5_P	85_G	0.506	0.79
180_V	210_R	0.506	0.79
104_D	111_A	0.506	0.79
38_P	41_P	0.505	0.79
29_D	93_A	0.504	0.79
182_A	185_D	0.502	0.79
106_L	113_D	0.501	0.79
149_D	160_L	0.500	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2x65A	2	0.9736	100	0.319	Contact Map
2cu2A	2	0.978	100	0.331	Contact Map
2qh5A	1	0.6388	100	0.645	Contact Map
3jukA	3	0.6344	99.4	0.822	Contact Map
3pnnA	1	0.7577	99.4	0.823	Contact Map
2e3dA	3	0.7093	99.3	0.826	Contact Map
2ux8A	4	0.7048	99.3	0.828	Contact Map
1jv1A	2	0.8987	99.2	0.837	Contact Map
2pa4A	3	0.7445	99.2	0.839	Contact Map
1yp2A	4	0.8722	99.1	0.842	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0083 seconds.