Q9HNC2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNC2 - Uncharacterized protein

UniProt:	Q9HNC2	Sequences: MSGAPTREVARRVFAAEFNDATFTFKESDDERAPLYALLPTGERANRVFVTGTLTETEDIGEDAEYWRGRVVDPTGTFFVYAGQYQPEAAAALRDAETPTYVAVVGKPRTYETDDGSVNVSLRPESITMVEESVRDRWVVEAAERTLDRIEAFNEEGNEYAERARAEYGADTSAYRQAVVDALAEFDAPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	190 (178)
Sequences:	176 (126)
Seq/√Len:	9.5

HALSA - Q9HNC2 Q9HQA3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_T	103_A	4.536	0.99
23_F	167_E	3.126	0.93
80_V	104_V	3.097	0.93
50_V	122_L	2.879	0.90
39_L	43_E	2.838	0.89
176_R	179_V	2.705	0.87
133_S	142_A	2.653	0.86
147_L	179_V	2.441	0.80
18_F	78_F	2.409	0.79
131_E	134_V	2.328	0.77
25_F	108_P	2.203	0.73
8_E	36_Y	2.146	0.70
172_T	176_R	2.109	0.69
28_S	33_A	2.095	0.69
19_N	109_R	2.075	0.68
171_D	175_Y	1.983	0.64
43_E	101_Y	1.975	0.64
46_N	86_Q	1.884	0.60
69_G	80_V	1.814	0.57
48_V	161_A	1.800	0.56
88_E	151_E	1.799	0.56
39_L	45_A	1.720	0.53
159_E	162_E	1.711	0.52
46_N	107_K	1.711	0.52
40_P	78_F	1.706	0.52
45_A	48_V	1.649	0.50
92_A	96_A	1.643	0.49
14_F	142_A	1.638	0.49
110_T	118_V	1.625	0.49
61_G	90_A	1.600	0.47
20_D	109_R	1.585	0.47
15_A	75_T	1.583	0.47
53_T	108_P	1.569	0.46
81_Y	84_Q	1.566	0.46
21_A	39_L	1.552	0.45
82_A	101_Y	1.550	0.45
6_T	65_E	1.508	0.43
13_V	122_L	1.452	0.41
112_E	116_G	1.409	0.39
69_G	104_V	1.396	0.39
103_A	120_V	1.383	0.38
135_R	139_V	1.380	0.38
13_V	71_V	1.366	0.37
9_V	123_R	1.359	0.37
46_N	146_T	1.344	0.36
46_N	81_Y	1.335	0.36
59_D	65_E	1.326	0.36
71_V	184_A	1.301	0.35
37_A	185_E	1.292	0.34
174_A	179_V	1.283	0.34
39_L	93_L	1.278	0.34
120_V	167_E	1.274	0.33
112_E	119_N	1.269	0.33
145_R	148_D	1.262	0.33
73_D	76_G	1.261	0.33
21_A	68_R	1.240	0.32
104_V	127_I	1.218	0.31
136_D	139_V	1.211	0.31
101_Y	170_A	1.208	0.31
176_R	184_A	1.201	0.31
150_I	175_Y	1.195	0.30
143_A	146_T	1.183	0.30
25_F	53_T	1.179	0.30
23_F	120_V	1.178	0.30
93_L	135_R	1.173	0.30
110_T	150_I	1.171	0.30
18_F	75_T	1.163	0.29
17_E	42_G	1.162	0.29
45_A	114_D	1.160	0.29
86_Q	123_R	1.157	0.29
171_D	176_R	1.156	0.29
53_T	93_L	1.150	0.29
180_V	184_A	1.143	0.29
44_R	160_Y	1.116	0.28
19_N	120_V	1.104	0.27
9_V	81_Y	1.100	0.27
157_G	165_R	1.098	0.27
54_L	91_A	1.094	0.27
59_D	116_G	1.089	0.27
110_T	184_A	1.077	0.26
47_R	125_E	1.074	0.26
147_L	150_I	1.069	0.26
69_G	90_A	1.069	0.26
93_L	130_V	1.064	0.26
32_R	96_A	1.033	0.25
50_V	166_A	1.029	0.25
57_T	171_D	1.028	0.25
69_G	95_D	1.021	0.24
18_F	108_P	1.020	0.24
143_A	183_L	1.019	0.24
61_G	67_W	1.018	0.24
174_A	181_D	1.016	0.24
11_R	24_T	1.004	0.24
57_T	160_Y	1.001	0.24
8_E	70_R	0.993	0.23
25_F	113_T	0.987	0.23
62_E	150_I	0.986	0.23
175_Y	179_V	0.986	0.23
87_P	123_R	0.985	0.23
19_N	67_W	0.982	0.23
181_D	184_A	0.980	0.23
140_V	144_E	0.978	0.23
39_L	184_A	0.977	0.23
39_L	167_E	0.972	0.23
51_T	99_P	0.965	0.22
75_T	103_A	0.961	0.22
29_D	32_R	0.944	0.22
125_E	138_W	0.933	0.22
70_R	99_P	0.931	0.21
7_R	47_R	0.913	0.21
69_G	87_P	0.908	0.21
34_P	46_N	0.905	0.21
38_L	113_T	0.904	0.21
66_Y	119_N	0.904	0.21
97_E	133_S	0.902	0.21
83_G	107_K	0.894	0.20
28_S	77_T	0.893	0.20
67_W	94_R	0.884	0.20
162_E	175_Y	0.882	0.20
58_E	123_R	0.881	0.20
96_A	159_E	0.874	0.20
68_R	121_S	0.872	0.20
18_F	157_G	0.870	0.20
108_P	113_T	0.866	0.20
150_I	179_V	0.865	0.20
81_Y	135_R	0.863	0.19
122_L	152_A	0.859	0.19
44_R	136_D	0.853	0.19
108_P	137_R	0.853	0.19
45_A	178_A	0.850	0.19
69_G	113_T	0.849	0.19
59_D	67_W	0.843	0.19
25_F	66_Y	0.841	0.19
57_T	113_T	0.839	0.19
15_A	54_L	0.836	0.19
71_V	172_T	0.834	0.19
118_V	132_E	0.829	0.19
20_D	28_S	0.829	0.19
32_R	150_I	0.818	0.18
81_Y	93_L	0.817	0.18
104_V	148_D	0.811	0.18
18_F	30_D	0.809	0.18
16_A	62_E	0.808	0.18
38_L	108_P	0.807	0.18
82_A	85_Y	0.804	0.18
35_L	92_A	0.799	0.18
14_F	138_W	0.794	0.18
143_A	147_L	0.787	0.17
27_E	33_A	0.779	0.17
29_D	51_T	0.777	0.17
21_A	91_A	0.773	0.17
44_R	179_V	0.772	0.17
21_A	45_A	0.771	0.17
78_F	124_P	0.771	0.17
65_E	69_G	0.768	0.17
89_A	142_A	0.764	0.17
23_F	39_L	0.764	0.17
36_Y	44_R	0.758	0.17
169_G	172_T	0.758	0.17
150_I	183_L	0.756	0.17
13_V	62_E	0.754	0.17
107_K	123_R	0.754	0.17
82_A	106_G	0.753	0.17
56_E	85_Y	0.752	0.17
144_E	175_Y	0.745	0.16
38_L	119_N	0.739	0.16
100_T	178_A	0.735	0.16
122_L	129_M	0.734	0.16
20_D	78_F	0.733	0.16
23_F	77_T	0.727	0.16
112_E	141_E	0.726	0.16
15_A	135_R	0.717	0.16
51_T	130_V	0.716	0.16
110_T	124_P	0.716	0.16
39_L	79_F	0.705	0.15
12_R	123_R	0.704	0.15
62_E	100_T	0.698	0.15
71_V	155_E	0.691	0.15
103_A	145_R	0.684	0.15
21_A	169_G	0.675	0.15
85_Y	93_L	0.674	0.15
61_G	117_S	0.671	0.15
61_G	94_R	0.670	0.15
96_A	104_V	0.670	0.15
6_T	69_G	0.669	0.15
12_R	70_R	0.669	0.15
54_L	134_V	0.667	0.15
69_G	94_R	0.666	0.15
43_E	167_E	0.659	0.14
30_D	150_I	0.657	0.14
90_A	185_E	0.650	0.14
13_V	166_A	0.650	0.14
40_P	82_A	0.650	0.14
104_V	122_L	0.648	0.14
57_T	119_N	0.641	0.14
20_D	153_F	0.639	0.14
13_V	100_T	0.639	0.14
26_K	152_A	0.638	0.14
54_L	83_G	0.637	0.14
46_N	143_A	0.636	0.14
60_I	171_D	0.635	0.14
71_V	152_A	0.634	0.14
49_F	103_A	0.634	0.14
75_T	143_A	0.633	0.14
86_Q	107_K	0.631	0.14
38_L	48_V	0.630	0.14
141_E	150_I	0.630	0.14
171_D	174_A	0.624	0.14
24_T	36_Y	0.623	0.14
18_F	140_V	0.622	0.14
7_R	85_Y	0.622	0.14
30_D	67_W	0.622	0.14
144_E	150_I	0.618	0.14
101_Y	141_E	0.618	0.14
122_L	145_R	0.616	0.13
82_A	89_A	0.616	0.13
6_T	59_D	0.610	0.13
20_D	76_G	0.609	0.13
106_G	115_D	0.609	0.13
19_N	28_S	0.607	0.13
50_V	91_A	0.604	0.13
39_L	119_N	0.592	0.13
176_R	181_D	0.592	0.13
132_E	136_D	0.591	0.13
80_V	152_A	0.590	0.13
43_E	131_E	0.589	0.13
16_A	174_A	0.586	0.13
53_T	113_T	0.583	0.13
41_T	136_D	0.580	0.13
65_E	182_A	0.579	0.13
85_Y	107_K	0.577	0.13
53_T	157_G	0.577	0.13
108_P	160_Y	0.575	0.13
18_F	117_S	0.575	0.13
44_R	142_A	0.569	0.13
170_A	173_S	0.569	0.13
50_V	115_D	0.567	0.12
58_E	74_P	0.564	0.12
173_S	177_Q	0.563	0.12
45_A	160_Y	0.559	0.12
46_N	123_R	0.557	0.12
58_E	118_V	0.548	0.12
119_N	160_Y	0.548	0.12
171_D	185_E	0.546	0.12
48_V	144_E	0.545	0.12
44_R	130_V	0.544	0.12
9_V	90_A	0.542	0.12
22_T	131_E	0.538	0.12
171_D	179_V	0.535	0.12
103_A	143_A	0.535	0.12
12_R	146_T	0.530	0.12
44_R	88_E	0.529	0.12
130_V	136_D	0.528	0.12
16_A	183_L	0.523	0.12
39_L	94_R	0.521	0.12
53_T	119_N	0.521	0.12
51_T	139_V	0.521	0.12
99_P	121_S	0.520	0.12
173_S	176_R	0.519	0.12
113_T	160_Y	0.518	0.12
25_F	79_F	0.516	0.12
86_Q	147_L	0.514	0.11
33_A	36_Y	0.513	0.11
57_T	92_A	0.506	0.11
143_A	179_V	0.505	0.11
172_T	185_E	0.500	0.11
133_S	157_G	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2pi2A	1	0.6737	98.2	0.879	Contact Map
4gnxB	1	0.6263	97.8	0.89	Contact Map
3mxnB	1	0.6421	96.9	0.906	Contact Map
3kdfD	2	0.6158	96.9	0.906	Contact Map
4joiA	1	0.6895	95.9	0.915	Contact Map
3kf6A	1	0.6789	90.8	0.931	Contact Map
1txyA	2	0.4211	77.3	0.943	Contact Map
4gs3A	2	0.4316	68.5	0.946	Contact Map
4gn4B	1	0.5368	62.5	0.948	Contact Map
3e0eA	1	0.4579	56.1	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.