Q9HNB8 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNB8 - Uncharacterized protein

UniProt:	Q9HNB8	Sequences: MPSAARRALRASGHLAPLFDAAPVRDTLRSLITRFVDGPDADERATGRAHIWGEVSSDATGETAVSRLVTPETYAFTVDAATTAAERTLDGDTPPGYQTPATAFGADFVTDLDGVTRTDDGDA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (111)
Sequences:	201 (178)
Seq/√Len:	16.9

HALSA - Q9HNB8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_P	115_V	4.817	1.00
80_A	112_L	3.895	1.00
25_R	29_R	3.120	0.99
20_D	25_R	2.759	0.98
48_R	69_V	2.731	0.97
80_A	109_V	2.708	0.97
84_A	104_F	2.697	0.97
104_F	108_F	2.251	0.92
54_E	63_T	2.236	0.92
41_A	45_A	1.981	0.86
27_T	31_L	1.860	0.82
87_R	111_D	1.845	0.82
82_T	85_A	1.843	0.82
47_G	72_E	1.785	0.79
101_A	108_F	1.710	0.76
78_V	82_T	1.566	0.70
22_A	26_D	1.525	0.67
25_R	101_A	1.522	0.67
84_A	108_F	1.493	0.66
85_A	114_G	1.419	0.62
55_V	64_A	1.411	0.61
57_S	60_T	1.405	0.61
34_R	88_T	1.397	0.60
7_R	11_A	1.344	0.57
8_A	11_A	1.322	0.56
29_R	101_A	1.299	0.55
57_S	62_E	1.274	0.53
80_A	116_T	1.270	0.53
19_F	51_I	1.266	0.53
58_D	82_T	1.261	0.52
53_G	78_V	1.221	0.50
29_R	53_G	1.219	0.50
32_I	79_D	1.214	0.50
83_T	112_L	1.194	0.48
72_E	76_F	1.187	0.48
83_T	86_E	1.177	0.47
83_T	87_R	1.166	0.47
44_R	75_A	1.131	0.45
25_R	28_L	1.130	0.45
36_V	73_T	1.122	0.44
49_A	112_L	1.114	0.44
6_R	13_G	1.110	0.43
49_A	70_T	1.098	0.43
63_T	109_V	1.088	0.42
32_I	114_G	1.086	0.42
15_L	86_E	1.082	0.42
14_H	17_P	1.070	0.41
98_Q	102_T	1.069	0.41
30_S	94_P	1.069	0.41
45_A	107_D	1.068	0.41
52_W	67_R	1.062	0.41
51_I	109_V	1.051	0.40
15_L	30_S	1.043	0.40
98_Q	103_A	1.017	0.38
5_A	9_L	1.014	0.38
79_D	112_L	1.010	0.38
67_R	81_A	1.007	0.38
49_A	73_T	1.006	0.37
85_A	88_T	1.003	0.37
82_T	113_D	1.001	0.37
70_T	76_F	0.988	0.36
10_R	35_F	0.980	0.36
27_T	51_I	0.967	0.35
44_R	73_T	0.942	0.34
20_D	29_R	0.941	0.34
56_S	63_T	0.939	0.34
8_A	81_A	0.934	0.34
95_P	98_Q	0.908	0.32
17_P	78_V	0.904	0.32
14_H	107_D	0.895	0.32
55_V	66_S	0.890	0.31
17_P	24_V	0.889	0.31
83_T	108_F	0.885	0.31
18_L	97_Y	0.870	0.30
68_L	85_A	0.868	0.30
40_D	94_P	0.864	0.30
36_V	75_A	0.856	0.30
6_R	32_I	0.853	0.29
15_L	88_T	0.849	0.29
91_G	111_D	0.844	0.29
62_E	76_F	0.837	0.29
28_L	67_R	0.833	0.28
27_T	32_I	0.832	0.28
18_L	94_P	0.810	0.27
9_L	97_Y	0.802	0.27
78_V	83_T	0.799	0.27
45_A	63_T	0.796	0.27
27_T	101_A	0.792	0.26
29_R	33_T	0.780	0.26
42_D	55_V	0.777	0.26
18_L	29_R	0.775	0.26
18_L	107_D	0.758	0.25
81_A	110_T	0.753	0.25
17_P	53_G	0.750	0.25
81_A	101_A	0.746	0.24
64_A	89_L	0.744	0.24
92_D	106_A	0.739	0.24
58_D	61_G	0.736	0.24
9_L	89_L	0.733	0.24
8_A	64_A	0.731	0.24
90_D	111_D	0.723	0.23
60_T	82_T	0.720	0.23
71_P	116_T	0.717	0.23
41_A	82_T	0.717	0.23
31_L	73_T	0.714	0.23
93_T	97_Y	0.711	0.23
10_R	94_P	0.710	0.23
36_V	104_F	0.708	0.23
68_L	115_V	0.707	0.23
15_L	21_A	0.700	0.22
40_D	62_E	0.694	0.22
88_T	97_Y	0.694	0.22
14_H	24_V	0.693	0.22
20_D	24_V	0.684	0.22
36_V	78_V	0.683	0.22
80_A	103_A	0.681	0.22
81_A	92_D	0.681	0.22
64_A	95_P	0.673	0.21
32_I	36_V	0.670	0.21
68_L	80_A	0.668	0.21
40_D	43_E	0.665	0.21
97_Y	111_D	0.663	0.21
38_G	100_P	0.647	0.20
38_G	74_Y	0.647	0.20
74_Y	100_P	0.647	0.20
70_T	110_T	0.641	0.20
56_S	80_A	0.639	0.20
78_V	103_A	0.635	0.20
56_S	110_T	0.629	0.20
42_D	45_A	0.623	0.19
31_L	41_A	0.614	0.19
50_H	67_R	0.608	0.19
48_R	97_Y	0.606	0.19
36_V	52_W	0.603	0.19
91_G	107_D	0.601	0.19
13_G	69_V	0.601	0.19
16_A	98_Q	0.599	0.19
42_D	106_A	0.592	0.18
107_D	110_T	0.590	0.18
11_A	34_R	0.587	0.18
52_W	89_L	0.582	0.18
91_G	95_P	0.578	0.18
22_A	107_D	0.577	0.18
21_A	81_A	0.576	0.18
9_L	88_T	0.574	0.18
45_A	93_T	0.572	0.18
103_A	108_F	0.570	0.18
71_P	110_T	0.569	0.17
37_D	73_T	0.566	0.17
20_D	49_A	0.555	0.17
33_T	104_F	0.551	0.17
5_A	32_I	0.550	0.17
9_L	32_I	0.547	0.17
53_G	72_E	0.547	0.17
9_L	15_L	0.542	0.17
109_V	112_L	0.539	0.16
11_A	73_T	0.538	0.16
25_R	83_T	0.528	0.16
13_G	115_V	0.527	0.16
21_A	40_D	0.524	0.16
8_A	108_F	0.523	0.16
14_H	93_T	0.519	0.16
29_R	51_I	0.515	0.16
41_A	106_A	0.508	0.15
98_Q	113_D	0.507	0.15
65_V	79_D	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4inaA	2	0.9431	96.2	0.851	Contact Map
3abiA	2	0.9024	93.1	0.875	Contact Map
4rl6A	2	0.9675	76.9	0.902	Contact Map
1ff9A	2	0.9756	21.5	0.933	Contact Map
1wu2A	2	0.7642	15.7	0.937	Contact Map
3fgyA	2	0.3984	8	0.944	Contact Map
4f55A	1	0.748	8	0.944	Contact Map
4p9fA	1	0.3659	6.7	0.946	Contact Map
4txdA	1	0.935	6.7	0.946	Contact Map
2eplX	2	0.6585	5.4	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.