Q9HNB4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNB4 - Uncharacterized protein

UniProt:	Q9HNB4	Sequences: MSVRSGTAGRDSTGMAKPVMWRVGVVVAMGQQPTPLVRRASEIDYADVSAGDGTRKGVLIDGEDGAPHFAMRRFELDPGARVPEHTNAVEHEQYVLAGEYTVGIEGDTHEVSAGDSLLIPAGAVHWYENDGDEPGAFICVVPNGDDDIQLVADEA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	155 (122)
Sequences:	351 (135)
Seq/√Len:	12.2

ECOLI - ALLE
HALSA - Q9HNB4
SULSO - Q97XY5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
97_A	133_E	7.035	1.00
77_D	134_P	3.934	0.99
36_L	60_I	3.398	0.98
76_L	80_A	2.655	0.92
39_R	42_E	2.586	0.91
99_E	132_D	2.446	0.88
27_V	30_G	2.333	0.86
45_Y	57_G	2.303	0.85
99_E	130_D	2.225	0.83
101_T	128_E	2.117	0.79
103_G	106_G	2.051	0.77
47_D	55_R	2.008	0.76
25_V	30_G	1.962	0.74
95_V	135_G	1.885	0.71
34_T	66_A	1.859	0.70
99_E	128_E	1.801	0.67
101_T	130_D	1.799	0.67
127_Y	135_G	1.727	0.64
25_V	28_A	1.712	0.63
80_A	103_G	1.609	0.58
81_R	128_E	1.605	0.58
35_P	43_I	1.570	0.56
96_L	124_V	1.537	0.54
86_T	90_E	1.499	0.53
85_H	92_E	1.477	0.51
24_G	28_A	1.467	0.51
61_D	117_L	1.455	0.50
60_I	67_P	1.449	0.50
84_E	103_G	1.438	0.49
44_D	55_R	1.425	0.49
97_A	134_P	1.421	0.49
30_G	66_A	1.418	0.48
24_G	84_E	1.383	0.47
102_V	125_H	1.340	0.45
24_G	63_E	1.315	0.43
81_R	132_D	1.315	0.43
23_V	83_P	1.288	0.42
108_T	125_H	1.264	0.41
45_Y	55_R	1.224	0.39
47_D	52_D	1.198	0.38
103_G	130_D	1.186	0.37
24_G	50_A	1.182	0.37
81_R	99_E	1.177	0.37
86_T	115_D	1.169	0.36
27_V	31_Q	1.152	0.35
85_H	102_V	1.126	0.34
61_D	84_E	1.121	0.34
26_V	31_Q	1.109	0.33
95_V	138_I	1.108	0.33
23_V	26_V	1.093	0.33
43_I	52_D	1.072	0.32
89_V	118_L	1.055	0.31
23_V	138_I	1.050	0.31
85_H	125_H	1.021	0.30
69_F	105_E	0.997	0.29
82_V	126_W	0.992	0.28
128_E	132_D	0.987	0.28
95_V	124_V	0.986	0.28
79_G	135_G	0.986	0.28
38_R	42_E	0.984	0.28
68_H	85_H	0.963	0.27
80_A	116_S	0.962	0.27
95_V	121_A	0.951	0.27
95_V	117_L	0.949	0.27
68_H	108_T	0.923	0.26
28_A	31_Q	0.921	0.26
23_V	49_S	0.914	0.25
71_M	75_E	0.878	0.24
28_A	77_D	0.876	0.24
43_I	46_A	0.863	0.23
92_E	102_V	0.851	0.23
114_G	119_I	0.849	0.23
95_V	127_Y	0.847	0.23
78_P	131_G	0.847	0.23
37_V	42_E	0.845	0.23
102_V	137_F	0.845	0.23
113_A	133_E	0.841	0.23
21_W	36_L	0.839	0.23
109_H	119_I	0.838	0.22
102_V	108_T	0.831	0.22
25_V	31_Q	0.829	0.22
87_N	92_E	0.825	0.22
32_Q	63_E	0.824	0.22
37_V	60_I	0.823	0.22
68_H	92_E	0.822	0.22
100_Y	137_F	0.816	0.22
51_G	130_D	0.807	0.21
43_I	71_M	0.805	0.21
42_E	45_Y	0.795	0.21
101_T	110_E	0.792	0.21
109_H	135_G	0.780	0.20
57_G	75_E	0.780	0.20
76_L	94_Y	0.777	0.20
57_G	112_S	0.774	0.20
57_G	129_N	0.774	0.20
34_T	67_P	0.771	0.20
33_P	66_A	0.769	0.20
81_R	112_S	0.758	0.20
32_Q	53_G	0.757	0.20
32_Q	138_I	0.750	0.20
72_R	89_V	0.749	0.19
99_E	110_E	0.747	0.19
32_Q	46_A	0.744	0.19
110_E	128_E	0.726	0.19
38_R	43_I	0.716	0.18
27_V	53_G	0.707	0.18
44_D	47_D	0.703	0.18
26_V	133_E	0.702	0.18
92_E	137_F	0.702	0.18
39_R	43_I	0.701	0.18
112_S	130_D	0.698	0.18
26_V	29_M	0.692	0.18
49_S	83_P	0.691	0.18
74_F	82_V	0.690	0.18
78_P	104_I	0.688	0.18
42_E	46_A	0.680	0.17
76_L	82_V	0.674	0.17
18_P	90_E	0.673	0.17
54_T	82_V	0.672	0.17
92_E	108_T	0.668	0.17
31_Q	42_E	0.668	0.17
85_H	137_F	0.667	0.17
43_I	138_I	0.666	0.17
114_G	121_A	0.665	0.17
19_V	100_Y	0.658	0.17
100_Y	133_E	0.657	0.17
59_L	73_R	0.653	0.17
51_G	132_D	0.652	0.17
37_V	64_D	0.650	0.17
34_T	123_A	0.645	0.16
124_V	129_N	0.643	0.16
73_R	104_I	0.642	0.16
57_G	136_A	0.640	0.16
23_V	114_G	0.638	0.16
90_E	111_V	0.632	0.16
43_I	57_G	0.629	0.16
92_E	125_H	0.627	0.16
126_W	135_G	0.620	0.16
21_W	88_A	0.619	0.16
80_A	118_L	0.619	0.16
44_D	88_A	0.614	0.16
17_K	27_V	0.607	0.15
41_S	60_I	0.604	0.15
103_G	116_S	0.594	0.15
110_E	132_D	0.591	0.15
37_V	62_G	0.578	0.15
68_H	125_H	0.577	0.15
26_V	30_G	0.575	0.15
69_F	89_V	0.573	0.14
114_G	136_A	0.567	0.14
17_K	26_V	0.567	0.14
92_E	122_G	0.564	0.14
32_Q	35_P	0.557	0.14
109_H	127_Y	0.554	0.14
50_A	87_N	0.553	0.14
33_P	68_H	0.551	0.14
93_Q	135_G	0.550	0.14
38_R	60_I	0.550	0.14
88_A	121_A	0.549	0.14
41_S	52_D	0.548	0.14
73_R	137_F	0.547	0.14
40_A	43_I	0.547	0.14
85_H	108_T	0.547	0.14
24_G	27_V	0.546	0.14
99_E	134_P	0.546	0.14
87_N	100_Y	0.545	0.14
79_G	90_E	0.543	0.14
86_T	94_Y	0.543	0.14
68_H	137_F	0.537	0.14
25_V	36_L	0.536	0.14
20_M	105_E	0.530	0.13
57_G	135_G	0.527	0.13
41_S	63_E	0.525	0.13
59_L	66_A	0.523	0.13
108_T	137_F	0.516	0.13
52_D	65_G	0.516	0.13
100_Y	117_L	0.514	0.13
93_Q	127_Y	0.512	0.13
106_G	113_A	0.509	0.13
109_H	126_W	0.509	0.13
60_I	69_F	0.502	0.13
99_E	112_S	0.500	0.13
116_S	126_W	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1sefA	5	0.9548	99.9	0.647	Contact Map
1rc6A	4	0.8903	99.9	0.663	Contact Map
1sq4A	5	0.9742	99.9	0.663	Contact Map
1sfnA	5	0.9355	99.9	0.669	Contact Map
4e2qA	6	0.929	99.8	0.687	Contact Map
3jzvA	5	0.8065	99.7	0.732	Contact Map
1vj2A	2	0.7226	99.7	0.734	Contact Map
3kgzA	2	0.8	99.6	0.737	Contact Map
3ibmA	2	0.8065	99.6	0.74	Contact Map
3ht1A	2	0.7871	99.6	0.741	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.