Q9HNA0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNA0 - Histidine triad protein

UniProt:	Q9HNA0	Sequences: MSDDCVFCQIIADEIPARVVHEDADTLAFLDATPMAPGHTLVIPKTHAATLADTPGDDATAVFETLHALAPTVEAAVDADATTIGFNNGTAAGQEVPHVHGHIIPRFADDDGGPLHVAAGTRPDVSDADLDATAADITDRLA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	142 (113)
Sequences:	5439 (3288)
Seq/√Len:	309.3

ECOLI - HINT
BACSU - HIT
HALSA - Q9HNA0 Q9HP05
SULSO - YHIT Q980P0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_C	8_C	3.090	1.00
22_E	45_K	3.038	1.00
46_T	58_D	2.924	1.00
25_D	61_A	2.505	1.00
8_C	47_H	2.497	1.00
5_C	47_H	2.389	1.00
18_R	30_L	2.176	1.00
26_T	65_T	2.176	1.00
13_D	19_V	2.127	1.00
55_P	58_D	2.091	1.00
80_D	91_A	2.029	1.00
56_G	67_H	2.028	1.00
23_D	61_A	2.001	1.00
29_F	43_I	2.001	1.00
86_F	101_G	1.990	1.00
66_L	101_G	1.968	1.00
19_V	27_L	1.810	1.00
20_V	40_T	1.751	1.00
9_Q	14_E	1.705	1.00
27_L	45_K	1.668	1.00
60_T	64_E	1.646	1.00
54_T	99_V	1.599	1.00
17_A	27_L	1.545	1.00
59_A	67_H	1.532	1.00
26_T	61_A	1.490	1.00
19_V	22_E	1.469	1.00
56_G	64_E	1.457	1.00
91_A	108_A	1.433	1.00
8_C	12_A	1.426	1.00
83_T	106_R	1.377	1.00
46_T	55_P	1.362	1.00
21_H	65_T	1.353	1.00
40_T	69_L	1.352	1.00
62_V	101_G	1.348	1.00
48_A	55_P	1.335	1.00
72_T	76_A	1.329	1.00
42_V	103_I	1.309	1.00
10_I	17_A	1.255	1.00
50_T	53_D	1.222	1.00
28_A	40_T	1.202	1.00
67_H	71_P	1.186	1.00
50_T	89_G	1.182	1.00
59_A	63_F	1.177	1.00
48_A	58_D	1.174	1.00
52_A	82_T	1.152	1.00
52_A	74_E	1.106	1.00
30_L	40_T	1.105	1.00
50_T	88_N	1.061	1.00
4_D	8_C	1.039	1.00
74_E	82_T	1.031	1.00
25_D	64_E	1.030	1.00
63_F	101_G	1.004	1.00
56_G	60_T	1.004	1.00
48_A	54_T	0.999	1.00
49_A	53_D	0.995	1.00
50_T	97_P	0.979	1.00
70_A	74_E	0.977	1.00
38_G	105_P	0.965	1.00
27_L	43_I	0.964	1.00
49_A	89_G	0.950	1.00
61_A	65_T	0.933	1.00
6_V	96_V	0.924	1.00
4_D	9_Q	0.920	1.00
62_V	99_V	0.917	1.00
83_T	87_N	0.913	1.00
9_Q	15_I	0.907	1.00
81_A	91_A	0.905	1.00
36_A	107_F	0.901	1.00
70_A	82_T	0.899	1.00
86_F	99_V	0.896	1.00
11_I	27_L	0.892	1.00
62_V	66_L	0.891	1.00
48_A	99_V	0.886	1.00
64_E	68_A	0.869	1.00
36_A	104_I	0.867	1.00
7_F	96_V	0.855	1.00
35_M	104_I	0.855	1.00
35_M	95_E	0.853	1.00
63_F	66_L	0.848	1.00
68_A	71_P	0.844	1.00
4_D	12_A	0.834	1.00
49_A	97_P	0.834	1.00
76_A	79_A	0.830	1.00
25_D	58_D	0.830	1.00
37_P	107_F	0.823	1.00
113_G	116_H	0.823	1.00
54_T	59_A	0.820	1.00
90_T	97_P	0.818	1.00
23_D	68_A	0.810	1.00
112_G	115_L	0.807	1.00
51_L	63_F	0.786	1.00
28_A	69_L	0.783	1.00
28_A	42_V	0.774	0.99
82_T	103_I	0.762	0.99
73_V	77_V	0.761	0.99
58_D	61_A	0.760	0.99
6_V	32_A	0.750	0.99
77_V	105_P	0.744	0.99
50_T	74_E	0.740	0.99
81_A	92_A	0.740	0.99
85_G	104_I	0.732	0.99
79_A	107_F	0.731	0.99
42_V	66_L	0.726	0.99
30_L	38_G	0.722	0.99
66_L	84_I	0.722	0.99
23_D	65_T	0.722	0.99
107_F	110_D	0.720	0.99
23_D	64_E	0.715	0.99
106_R	109_D	0.714	0.99
23_D	26_T	0.712	0.99
89_G	92_A	0.708	0.99
80_D	108_A	0.708	0.99
48_A	53_D	0.705	0.99
54_T	58_D	0.701	0.99
40_T	103_I	0.693	0.99
20_V	30_L	0.690	0.99
94_Q	97_P	0.687	0.99
80_D	107_F	0.684	0.99
6_V	9_Q	0.680	0.99
18_R	32_A	0.678	0.99
51_L	86_F	0.677	0.99
106_R	110_D	0.673	0.99
51_L	84_I	0.673	0.99
11_I	43_I	0.669	0.98
11_I	45_K	0.668	0.98
71_P	75_A	0.667	0.98
64_E	67_H	0.665	0.98
74_E	79_A	0.650	0.98
84_I	88_N	0.647	0.98
21_H	68_A	0.646	0.98
83_T	104_I	0.636	0.98
28_A	65_T	0.630	0.98
10_I	32_A	0.628	0.98
68_A	72_T	0.622	0.98
6_V	15_I	0.618	0.97
51_L	67_H	0.616	0.97
25_D	46_T	0.615	0.97
52_A	103_I	0.612	0.97
26_T	62_V	0.606	0.97
13_D	17_A	0.597	0.97
10_I	29_F	0.592	0.97
19_V	45_K	0.591	0.97
66_L	73_V	0.577	0.96
15_I	32_A	0.577	0.96
73_V	103_I	0.576	0.96
13_D	22_E	0.575	0.96
56_G	59_A	0.574	0.96
71_P	74_E	0.568	0.96
46_T	57_D	0.568	0.96
5_C	98_H	0.559	0.95
61_A	64_E	0.558	0.95
40_T	72_T	0.551	0.95
111_D	114_P	0.551	0.95
83_T	92_A	0.550	0.95
8_C	11_I	0.546	0.95
90_T	108_A	0.546	0.95
54_T	62_V	0.544	0.95
35_M	85_G	0.537	0.94
31_D	87_N	0.533	0.94
52_A	88_N	0.532	0.94
72_T	75_A	0.530	0.94
40_T	73_V	0.525	0.94
92_A	95_E	0.525	0.94
47_H	98_H	0.516	0.93
14_E	22_E	0.515	0.93
11_I	17_A	0.513	0.93
10_I	43_I	0.511	0.93
7_F	43_I	0.505	0.92
74_E	89_G	0.505	0.92
62_V	65_T	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ksvA	2	0.9648	100	0.188	Contact Map
3lb5A	2	0.9507	100	0.231	Contact Map
3imiA	2	0.993	100	0.237	Contact Map
3l7xA	2	0.9718	100	0.238	Contact Map
1y23A	2	0.9789	100	0.249	Contact Map
2eo4A	2	0.9648	100	0.258	Contact Map
3o0mA	2	0.9225	100	0.267	Contact Map
3anoA	4	0.9789	100	0.272	Contact Map
1emsA	3	0.8873	100	0.273	Contact Map
1fitA	2	0.8873	100	0.296	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.