Q9HN94 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HN94 - Cytochrome c oxidase subunit II

UniProt:	Q9HN94	Sequences: MVGDDGGTVNPDNPTAADNFRDPGVYQADDDSYDVYVEARQFAFSPGTSEPIRVPADTNVTFHVTSGDVTHGFELVGTNVNTMVIPGQVAQLTVNFDEARTHHIVCHEYCGPAHHAMEGSIEVVPQSEFTPPQQAAADQSEVTDT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (113)
Sequences:	5077 (2484)
Seq/√Len:	233.6

ECOLI - CYOA
BACSU - QOX2 COX2
HALSA - Q9HN94 Q9HRJ9
SULSO - Q97UN4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_R	124_V	3.104	1.00
125_P	128_E	2.944	1.00
58_T	126_Q	2.787	1.00
64_V	84_V	2.759	1.00
126_Q	130_T	2.607	1.00
40_R	45_S	2.477	1.00
35_V	52_I	2.419	1.00
96_F	123_V	2.384	1.00
56_A	123_V	2.191	1.00
54_V	96_F	2.018	1.00
56_A	99_A	1.958	1.00
62_F	94_V	1.956	1.00
51_P	122_E	1.924	1.00
99_A	125_P	1.903	1.00
36_Y	47_G	1.836	1.00
34_D	61_T	1.798	1.00
101_T	120_S	1.735	1.00
81_N	108_E	1.669	1.00
32_S	58_T	1.569	1.00
40_R	67_G	1.563	1.00
40_R	43_A	1.546	1.00
38_E	65_T	1.541	1.00
74_E	107_H	1.541	1.00
36_Y	63_H	1.511	1.00
54_V	121_I	1.500	1.00
124_V	128_E	1.485	1.00
39_A	84_V	1.478	1.00
106_C	110_C	1.471	1.00
34_D	63_H	1.462	1.00
104_I	119_G	1.457	1.00
59_N	95_N	1.445	1.00
72_G	81_N	1.429	1.00
38_E	47_G	1.416	1.00
61_T	91_Q	1.390	1.00
101_T	122_E	1.362	1.00
72_G	107_H	1.347	1.00
78_T	121_I	1.324	1.00
51_P	120_S	1.323	1.00
83_M	108_E	1.317	1.00
71_H	106_C	1.303	1.00
99_A	123_V	1.291	1.00
56_A	126_Q	1.287	1.00
82_T	92_L	1.273	1.00
53_R	122_E	1.235	1.00
71_H	110_C	1.206	1.00
110_C	114_H	1.183	1.00
63_H	89_V	1.181	1.00
32_S	59_N	1.178	1.00
64_V	82_T	1.168	1.00
128_E	131_P	1.159	1.00
78_T	96_F	1.138	1.00
33_Y	129_F	1.135	1.00
72_G	108_E	1.122	1.00
37_V	62_F	1.120	1.00
60_V	96_F	1.085	1.00
46_P	52_I	1.077	1.00
36_Y	65_T	1.065	1.00
79_N	94_V	1.050	1.00
106_C	114_H	1.031	1.00
46_P	119_G	1.005	1.00
54_V	60_V	0.995	1.00
105_V	118_E	0.986	1.00
134_Q	137_A	0.973	1.00
106_C	117_M	0.969	1.00
81_N	107_H	0.959	1.00
29_D	32_S	0.954	1.00
103_H	120_S	0.950	1.00
56_A	125_P	0.942	1.00
103_H	118_E	0.941	1.00
35_V	62_F	0.939	1.00
75_L	121_I	0.934	1.00
130_T	134_Q	0.917	1.00
82_T	90_A	0.900	0.99
102_H	123_V	0.885	0.99
51_P	101_T	0.882	0.99
35_V	54_V	0.877	0.99
54_V	94_V	0.856	0.99
113_A	116_A	0.839	0.99
29_D	93_T	0.839	0.99
65_T	89_V	0.839	0.99
59_N	93_T	0.830	0.99
50_E	136_A	0.828	0.99
63_H	91_Q	0.817	0.99
131_P	135_A	0.807	0.99
131_P	134_Q	0.804	0.99
29_D	59_N	0.802	0.99
42_F	69_V	0.785	0.99
104_I	121_I	0.760	0.98
46_P	104_I	0.755	0.98
68_D	71_H	0.755	0.98
46_P	73_F	0.750	0.98
37_V	46_P	0.746	0.98
48_T	129_F	0.739	0.98
54_V	123_V	0.734	0.98
41_Q	68_D	0.732	0.98
61_T	93_T	0.730	0.98
68_D	86_P	0.728	0.98
99_A	128_E	0.717	0.98
41_Q	109_Y	0.716	0.97
41_Q	69_V	0.715	0.97
83_M	107_H	0.715	0.97
74_E	80_V	0.706	0.97
79_N	104_I	0.699	0.97
66_S	84_V	0.686	0.97
62_F	92_L	0.679	0.97
73_F	121_I	0.674	0.96
35_V	48_T	0.665	0.96
110_C	117_M	0.663	0.96
68_D	106_C	0.661	0.96
99_A	102_H	0.659	0.96
69_V	108_E	0.655	0.96
32_S	126_Q	0.652	0.96
57_D	97_D	0.651	0.96
37_V	64_V	0.648	0.96
71_H	114_H	0.645	0.95
75_L	78_T	0.644	0.95
85_I	88_Q	0.643	0.95
25_V	29_D	0.641	0.95
80_V	92_L	0.640	0.95
25_V	28_A	0.640	0.95
62_F	73_F	0.639	0.95
45_S	67_G	0.638	0.95
37_V	73_F	0.631	0.95
43_A	113_A	0.629	0.95
127_S	131_P	0.619	0.94
57_D	95_N	0.618	0.94
74_E	105_V	0.618	0.94
78_T	123_V	0.608	0.94
66_S	70_T	0.606	0.94
114_H	117_M	0.606	0.94
55_P	60_V	0.603	0.93
39_A	44_F	0.601	0.93
109_Y	112_P	0.593	0.93
99_A	124_V	0.593	0.93
26_Y	29_D	0.581	0.92
44_F	104_I	0.574	0.92
28_A	93_T	0.571	0.91
44_F	84_V	0.560	0.91
129_F	133_Q	0.558	0.91
80_V	94_V	0.556	0.90
80_V	104_I	0.554	0.90
42_F	112_P	0.551	0.90
74_E	81_N	0.551	0.90
42_F	105_V	0.549	0.90
73_F	80_V	0.546	0.90
31_D	58_T	0.546	0.90
31_D	61_T	0.544	0.89
124_V	129_F	0.541	0.89
46_P	51_P	0.541	0.89
57_D	123_V	0.539	0.89
107_H	114_H	0.539	0.89
132_P	136_A	0.538	0.89
33_Y	58_T	0.538	0.89
79_N	90_A	0.536	0.89
28_A	59_N	0.534	0.89
74_E	115_H	0.531	0.88
48_T	132_P	0.530	0.88
29_D	57_D	0.525	0.88
68_D	114_H	0.523	0.88
70_T	85_I	0.523	0.88
52_I	62_F	0.520	0.87
56_A	96_F	0.518	0.87
33_Y	60_V	0.518	0.87
133_Q	137_A	0.516	0.87
39_A	71_H	0.508	0.86
60_V	94_V	0.507	0.86
75_L	100_R	0.502	0.85
25_V	59_N	0.502	0.85
108_E	114_H	0.502	0.85
132_P	135_A	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fftB	1	0.9931	100	0.193	Contact Map
4txvB	1	0.8276	100	0.204	Contact Map
1cyxA	1	0.7931	100	0.208	Contact Map
3hb3B	1	0.9793	100	0.225	Contact Map
1v54B	1	0.9448	100	0.23	Contact Map
2gsmB	1	0.9586	100	0.255	Contact Map
2yevB	1	1	100	0.294	Contact Map
2cuaA	1	0.8276	100	0.433	Contact Map
3s8fB	1	0.8414	100	0.46	Contact Map
3sbqA	2	0.8345	99.9	0.539	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.