Q9HN65 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HN65 - Uncharacterized protein

UniProt:	Q9HN65	Sequences: MGGPISTGKEANVYEALDAEGGDVALKVYRINASNFQQMRAYLEGDPRFEGLRGDKKAVVLSWTRKEFSNLRRAKAAGVRVPAPLAVQRNVLVMELIGREGDAAPTLSDVDIENPQMAYEVVREYVRRLYDAGLVHGDLSEYNVVVYEGELVVIDVGQAVTIHHPNSATFLERDCRNVANFFARQGADADPDDLLSYVHEHATPRAEADTAAGDRDGTEGSLDRGSDADDA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	231 (200)
Sequences:	1425 (834)
Seq/√Len:	59.0

HALSA - Q9HN65 Q9HSL0
SULSO - Q97W63 Q980T1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
144_V	153_V	4.363	1.00
97_I	104_A	3.742	1.00
125_Y	153_V	3.509	1.00
122_V	151_L	3.176	1.00
18_D	22_G	2.992	1.00
121_V	150_E	2.985	1.00
97_I	152_V	2.815	1.00
144_V	151_L	2.785	1.00
123_R	194_L	2.766	1.00
80_R	150_E	2.723	1.00
75_K	83_A	2.633	1.00
83_A	95_E	2.605	1.00
104_A	107_L	2.538	1.00
129_L	153_V	2.486	1.00
80_R	125_Y	2.418	1.00
74_A	129_L	2.332	1.00
26_L	93_V	2.321	1.00
126_V	139_L	2.246	1.00
144_V	178_V	2.223	1.00
18_D	24_V	2.104	1.00
118_A	146_V	2.097	1.00
38_Q	41_A	2.096	1.00
38_Q	42_Y	2.029	1.00
126_V	175_C	2.008	1.00
118_A	151_L	1.978	1.00
28_V	91_V	1.958	1.00
74_A	156_V	1.947	1.00
126_V	178_V	1.939	1.00
5_I	25_A	1.919	1.00
168_A	172_E	1.913	1.00
75_K	84_P	1.904	1.00
74_A	79_V	1.808	0.99
126_V	198_V	1.759	0.99
7_T	12_N	1.742	0.99
119_Y	179_A	1.694	0.99
24_V	85_L	1.693	0.99
129_L	156_V	1.640	0.99
140_S	177_N	1.617	0.99
176_R	180_N	1.608	0.99
4_P	12_N	1.574	0.99
145_V	154_I	1.560	0.98
122_V	144_V	1.544	0.98
16_A	93_V	1.539	0.98
64_T	87_V	1.476	0.98
85_L	95_E	1.449	0.97
66_K	70_N	1.429	0.97
195_L	199_H	1.412	0.97
16_A	24_V	1.403	0.97
15_E	23_D	1.393	0.97
55_D	58_A	1.389	0.97
65_R	87_V	1.375	0.97
124_E	128_R	1.368	0.96
13_V	25_A	1.364	0.96
127_R	197_Y	1.361	0.96
127_R	131_D	1.354	0.96
118_A	122_V	1.339	0.96
147_Y	152_V	1.329	0.96
42_Y	63_W	1.309	0.95
22_G	83_A	1.307	0.95
176_R	191_P	1.297	0.95
72_R	76_A	1.291	0.95
122_V	178_V	1.287	0.95
193_D	196_S	1.276	0.95
70_N	159_A	1.273	0.95
29_Y	92_L	1.242	0.94
125_Y	128_R	1.235	0.94
172_E	195_L	1.222	0.93
175_C	194_L	1.197	0.93
58_A	61_L	1.192	0.92
117_M	121_V	1.185	0.92
57_K	88_Q	1.183	0.92
121_V	151_L	1.176	0.92
127_R	198_V	1.159	0.91
190_D	193_D	1.150	0.91
4_P	14_Y	1.148	0.91
40_R	44_E	1.145	0.91
99_R	148_E	1.138	0.91
30_R	129_L	1.137	0.91
183_A	190_D	1.131	0.90
16_A	26_L	1.118	0.90
146_V	149_G	1.103	0.89
135_V	186_G	1.097	0.89
87_V	90_N	1.084	0.88
68_F	84_P	1.078	0.88
181_F	185_Q	1.062	0.87
172_E	176_R	1.053	0.87
137_G	170_F	1.053	0.87
52_L	55_D	1.052	0.87
112_I	118_A	1.051	0.87
15_E	96_L	1.050	0.87
98_G	147_Y	1.041	0.86
12_N	30_R	1.036	0.86
51_G	99_R	1.022	0.85
61_L	90_N	1.017	0.85
112_I	115_P	1.014	0.85
65_R	73_R	1.003	0.84
96_L	101_G	1.000	0.84
123_R	126_V	0.997	0.84
79_V	125_Y	0.983	0.83
103_A	106_T	0.982	0.83
122_V	153_V	0.978	0.83
70_N	156_V	0.964	0.82
80_R	121_V	0.950	0.81
113_E	116_Q	0.948	0.81
81_V	95_E	0.945	0.80
29_Y	63_W	0.945	0.80
121_V	125_Y	0.944	0.80
42_Y	46_D	0.943	0.80
101_G	107_L	0.928	0.79
110_V	125_Y	0.917	0.78
156_V	159_A	0.916	0.78
19_A	129_L	0.911	0.78
154_I	158_Q	0.905	0.77
104_A	147_Y	0.901	0.77
6_S	156_V	0.896	0.77
12_N	33_A	0.893	0.76
117_M	149_G	0.881	0.75
97_I	147_Y	0.880	0.75
116_Q	149_G	0.874	0.75
29_Y	45_G	0.871	0.75
97_I	194_L	0.870	0.74
133_G	157_G	0.869	0.74
7_T	90_N	0.863	0.74
191_P	194_L	0.856	0.73
137_G	173_R	0.836	0.72
60_V	90_N	0.835	0.71
125_Y	139_L	0.833	0.71
10_E	36_F	0.829	0.71
19_A	117_M	0.827	0.71
116_Q	187_A	0.824	0.70
74_A	157_G	0.821	0.70
32_N	56_K	0.819	0.70
75_K	95_E	0.815	0.70
196_S	201_H	0.812	0.69
173_R	177_N	0.810	0.69
24_V	93_V	0.809	0.69
196_S	200_E	0.805	0.69
42_Y	45_G	0.804	0.69
48_R	70_N	0.802	0.68
15_E	137_G	0.801	0.68
15_E	30_R	0.791	0.67
139_L	177_N	0.790	0.67
118_A	182_F	0.787	0.67
137_G	162_I	0.785	0.67
31_I	57_K	0.776	0.66
115_P	121_V	0.774	0.66
46_D	70_N	0.771	0.65
70_N	140_S	0.763	0.64
66_K	141_E	0.762	0.64
61_L	65_R	0.756	0.64
130_Y	171_L	0.755	0.64
29_Y	157_G	0.755	0.64
43_L	59_V	0.755	0.64
32_N	35_N	0.746	0.63
151_L	178_V	0.741	0.62
119_Y	123_R	0.740	0.62
47_P	92_L	0.740	0.62
78_G	81_V	0.739	0.62
14_Y	38_Q	0.736	0.62
33_A	90_N	0.736	0.62
134_L	159_A	0.731	0.61
2_G	15_E	0.731	0.61
47_P	74_A	0.729	0.61
57_K	92_L	0.724	0.60
45_G	63_W	0.724	0.60
116_Q	142_Y	0.722	0.60
123_R	188_D	0.717	0.60
138_D	143_N	0.714	0.59
166_N	169_T	0.712	0.59
190_D	200_E	0.710	0.59
6_S	142_Y	0.710	0.59
26_L	157_G	0.709	0.59
62_S	118_A	0.709	0.59
99_R	184_R	0.707	0.59
103_A	145_V	0.705	0.58
36_F	157_G	0.702	0.58
191_P	197_Y	0.700	0.58
144_V	166_N	0.695	0.57
113_E	117_M	0.695	0.57
168_A	180_N	0.695	0.57
179_A	191_P	0.694	0.57
6_S	32_N	0.694	0.57
85_L	142_Y	0.691	0.57
66_K	164_H	0.691	0.57
103_A	109_D	0.690	0.57
31_I	35_N	0.689	0.57
194_L	198_V	0.689	0.57
172_E	196_S	0.688	0.57
14_Y	41_A	0.687	0.56
130_Y	198_V	0.684	0.56
57_K	61_L	0.680	0.56
38_Q	163_H	0.680	0.56
30_R	56_K	0.678	0.55
12_N	49_F	0.676	0.55
31_I	39_M	0.675	0.55
35_N	135_V	0.671	0.55
60_V	63_W	0.667	0.54
139_L	194_L	0.666	0.54
68_F	72_R	0.665	0.54
11_A	73_R	0.665	0.54
126_V	176_R	0.662	0.54
103_A	156_V	0.662	0.54
128_R	183_A	0.661	0.54
113_E	148_E	0.657	0.53
66_K	134_L	0.656	0.53
175_C	179_A	0.655	0.53
111_D	149_G	0.654	0.53
35_N	50_E	0.649	0.52
191_P	201_H	0.646	0.52
141_E	178_V	0.636	0.51
46_D	162_I	0.635	0.51
89_R	173_R	0.633	0.50
106_T	137_G	0.629	0.50
71_L	91_V	0.629	0.50
139_L	153_V	0.628	0.50
59_V	87_V	0.625	0.50
112_I	153_V	0.624	0.49
133_G	162_I	0.624	0.49
99_R	117_M	0.624	0.49
35_N	41_A	0.613	0.48
100_E	111_D	0.612	0.48
191_P	200_E	0.610	0.48
49_F	134_L	0.607	0.48
176_R	198_V	0.607	0.48
79_V	139_L	0.606	0.47
189_A	196_S	0.599	0.47
45_G	66_K	0.598	0.47
6_S	159_A	0.598	0.47
65_R	90_N	0.595	0.46
138_D	154_I	0.591	0.46
79_V	129_L	0.591	0.46
42_Y	140_S	0.588	0.45
9_K	138_D	0.586	0.45
179_A	194_L	0.582	0.45
160_V	164_H	0.581	0.45
40_R	172_E	0.579	0.44
122_V	125_Y	0.578	0.44
168_A	199_H	0.575	0.44
63_W	98_G	0.574	0.44
88_Q	92_L	0.572	0.44
56_K	59_V	0.571	0.44
73_R	134_L	0.569	0.43
63_W	70_N	0.568	0.43
24_V	95_E	0.564	0.43
16_A	71_L	0.562	0.43
136_H	143_N	0.561	0.42
7_T	73_R	0.561	0.42
98_G	151_L	0.560	0.42
126_V	191_P	0.558	0.42
39_M	43_L	0.556	0.42
49_F	164_H	0.554	0.42
63_W	104_A	0.551	0.41
121_V	191_P	0.550	0.41
122_V	176_R	0.550	0.41
194_L	199_H	0.549	0.41
100_E	149_G	0.549	0.41
35_N	43_L	0.547	0.41
74_A	158_Q	0.547	0.41
9_K	27_K	0.546	0.41
74_A	81_V	0.545	0.41
37_Q	182_F	0.545	0.41
30_R	38_Q	0.544	0.41
109_D	168_A	0.542	0.40
19_A	148_E	0.542	0.40
140_S	171_L	0.541	0.40
116_Q	120_E	0.538	0.40
55_D	106_T	0.536	0.40
24_V	89_R	0.535	0.40
60_V	157_G	0.534	0.40
120_E	149_G	0.533	0.39
131_D	199_H	0.532	0.39
143_N	155_D	0.531	0.39
131_D	201_H	0.531	0.39
68_F	188_D	0.529	0.39
134_L	156_V	0.528	0.39
180_N	184_R	0.527	0.39
79_V	132_A	0.527	0.39
30_R	158_Q	0.527	0.39
177_N	180_N	0.525	0.39
6_S	12_N	0.525	0.39
10_E	27_K	0.524	0.38
96_L	102_D	0.523	0.38
183_A	188_D	0.520	0.38
123_R	175_C	0.519	0.38
75_K	81_V	0.519	0.38
118_A	147_Y	0.516	0.38
128_R	150_E	0.514	0.37
135_V	169_T	0.514	0.37
5_I	13_V	0.513	0.37
26_L	86_A	0.513	0.37
56_K	64_T	0.512	0.37
13_V	169_T	0.511	0.37
73_R	161_T	0.511	0.37
156_V	161_T	0.511	0.37
30_R	90_N	0.510	0.37
123_R	179_A	0.508	0.37
3_G	170_F	0.506	0.37
40_R	53_R	0.504	0.36
148_E	200_E	0.503	0.36
37_Q	41_A	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4gyiA	1	0.8528	100	0.553	Contact Map
1zarA	1	0.7532	100	0.56	Contact Map
1zthA	1	0.8182	100	0.591	Contact Map
4otpA	1	0.8658	100	0.657	Contact Map
4pedA	1	0.974	99.7	0.776	Contact Map
2zmdA	2	0.8182	99.5	0.801	Contact Map
4bvuA	1	0.684	99.5	0.805	Contact Map
3en9A	1	0.8268	99.5	0.809	Contact Map
4h05A	1	0.7619	99.4	0.811	Contact Map
2y7jA	3	0.9048	99.4	0.814	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.