Q9HN57 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HN57 - Uncharacterized protein

UniProt:	Q9HN57	Sequences: MDPLLARAACNLARVTPGDRVLDPMCGTGGVLIEAGLLGAHPIGTDAQAKMAAGARRNLTHYVDDATTGRADATALPLPSDSIDAAVLDAPYGRQSKIATHDLADLVGGALDELARVTAGRCVLVADRDWRAEATAAGWTVDARFQRRVHRSLVRHVLVLA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (150)
Sequences:	2900 (1886)
Seq/√Len:	154.0

ECOLI - RLMKL
BACSU - YPSC
HALSA - Q9HN57
SULSO - Q97Z87

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_L	44_G	4.662	1.00
59_L	68_T	4.388	1.00
59_L	64_D	3.351	1.00
84_D	120_G	3.082	1.00
26_C	44_G	2.771	1.00
52_A	68_T	2.733	1.00
144_R	156_H	2.688	1.00
49_A	70_R	2.518	1.00
32_L	42_P	2.456	1.00
52_A	70_R	2.435	1.00
72_D	75_A	2.324	1.00
11_N	38_L	2.244	1.00
45_T	71_A	2.223	1.00
9_A	31_V	2.163	1.00
22_L	76_L	2.079	1.00
9_A	157_V	2.064	1.00
114_L	122_C	1.937	1.00
21_V	87_V	1.917	1.00
10_C	13_A	1.909	1.00
110_A	114_L	1.894	1.00
22_L	45_T	1.804	1.00
98_I	102_D	1.704	1.00
21_V	42_P	1.659	1.00
13_A	85_A	1.610	1.00
53_A	56_R	1.606	1.00
59_L	66_A	1.604	1.00
41_H	67_T	1.603	1.00
74_T	109_G	1.597	1.00
55_A	68_T	1.566	1.00
37_L	64_D	1.538	1.00
51_M	54_G	1.528	1.00
25_M	88_L	1.526	1.00
44_G	55_A	1.495	1.00
113_E	117_V	1.461	1.00
29_G	55_A	1.444	1.00
45_T	76_L	1.410	1.00
15_V	21_V	1.406	1.00
16_T	19_D	1.403	1.00
52_A	55_A	1.387	1.00
70_R	98_I	1.363	1.00
57_R	60_T	1.351	1.00
114_L	118_T	1.346	1.00
73_A	113_E	1.346	1.00
122_C	137_A	1.306	1.00
20_R	119_A	1.296	1.00
13_A	123_V	1.293	1.00
131_R	154_V	1.293	1.00
24_P	88_L	1.291	1.00
88_L	124_L	1.257	1.00
21_V	32_L	1.221	1.00
109_G	112_D	1.220	1.00
83_I	119_A	1.206	1.00
32_L	59_L	1.195	1.00
73_A	110_A	1.183	1.00
29_G	44_G	1.161	1.00
31_V	87_V	1.146	1.00
103_L	107_V	1.144	1.00
42_P	66_A	1.139	1.00
107_V	126_A	1.139	1.00
26_C	29_G	1.130	1.00
15_V	125_V	1.120	1.00
113_E	116_R	1.107	0.99
32_L	66_A	1.106	0.99
115_A	139_W	1.069	0.99
32_L	68_T	1.069	0.99
112_D	116_R	1.049	0.99
150_H	153_L	1.032	0.99
99_A	104_A	1.020	0.99
21_V	35_A	1.015	0.99
19_D	85_A	1.010	0.99
104_A	136_A	1.006	0.99
132_A	136_A	1.005	0.99
92_Y	150_H	1.004	0.99
141_V	144_R	1.004	0.99
134_A	137_A	1.001	0.99
71_A	75_A	0.998	0.99
45_T	69_G	0.995	0.99
9_A	87_V	0.994	0.99
92_Y	95_Q	0.967	0.99
92_Y	130_W	0.967	0.99
12_L	145_F	0.949	0.98
10_C	31_V	0.947	0.98
29_G	68_T	0.946	0.98
21_V	31_V	0.941	0.98
78_L	82_S	0.940	0.98
22_L	118_T	0.939	0.98
20_R	41_H	0.934	0.98
72_D	109_G	0.921	0.98
150_H	155_R	0.918	0.98
19_D	121_R	0.915	0.98
36_G	42_P	0.913	0.98
46_D	51_M	0.885	0.97
64_D	68_T	0.883	0.97
36_G	64_D	0.882	0.97
43_I	69_G	0.880	0.97
7_R	89_D	0.868	0.97
133_E	137_A	0.856	0.97
34_E	37_L	0.853	0.97
88_L	110_A	0.852	0.97
9_A	125_V	0.844	0.97
57_R	61_H	0.842	0.97
47_A	72_D	0.841	0.97
97_K	133_E	0.833	0.96
41_H	81_D	0.819	0.96
53_A	57_R	0.813	0.96
23_D	91_P	0.803	0.96
132_A	135_T	0.803	0.96
13_A	34_E	0.802	0.95
33_I	64_D	0.799	0.95
10_C	21_V	0.780	0.95
78_L	81_D	0.779	0.95
118_T	139_W	0.773	0.94
20_R	84_D	0.765	0.94
146_Q	156_H	0.765	0.94
111_L	138_G	0.756	0.94
56_R	68_T	0.756	0.94
29_G	59_L	0.751	0.94
79_P	82_S	0.750	0.94
93_G	97_K	0.747	0.93
82_S	119_A	0.747	0.93
16_T	85_A	0.745	0.93
86_A	114_L	0.745	0.93
143_A	146_Q	0.744	0.93
113_E	118_T	0.740	0.93
15_V	35_A	0.736	0.93
76_L	113_E	0.733	0.93
123_V	145_F	0.732	0.93
46_D	52_A	0.729	0.93
22_L	43_I	0.728	0.93
105_D	109_G	0.726	0.92
127_D	153_L	0.725	0.92
33_I	66_A	0.721	0.92
131_R	144_R	0.717	0.92
48_Q	51_M	0.712	0.92
114_L	137_A	0.707	0.91
53_A	67_T	0.705	0.91
10_C	87_V	0.699	0.91
25_M	106_L	0.685	0.90
4_L	7_R	0.683	0.90
10_C	85_A	0.682	0.90
102_D	105_D	0.680	0.90
125_V	136_A	0.676	0.90
19_D	83_I	0.672	0.89
135_T	139_W	0.669	0.89
56_R	69_G	0.668	0.89
5_L	94_R	0.665	0.89
10_C	35_A	0.664	0.89
89_D	95_Q	0.662	0.89
9_A	147_R	0.660	0.88
5_L	8_A	0.655	0.88
12_L	147_R	0.655	0.88
5_L	150_H	0.654	0.88
20_R	82_S	0.652	0.88
144_R	154_V	0.642	0.87
43_I	67_T	0.641	0.87
23_D	44_G	0.632	0.86
28_T	89_D	0.632	0.86
34_E	87_V	0.628	0.86
114_L	124_L	0.622	0.85
52_A	56_R	0.622	0.85
10_C	32_L	0.616	0.85
30_G	125_V	0.613	0.84
114_L	117_V	0.612	0.84
105_D	108_G	0.611	0.84
36_G	62_Y	0.610	0.84
44_G	66_A	0.609	0.84
151_R	154_V	0.606	0.84
122_C	153_L	0.604	0.84
134_A	141_V	0.602	0.83
89_D	96_S	0.601	0.83
123_V	157_V	0.600	0.83
30_G	89_D	0.596	0.83
103_L	133_E	0.593	0.82
134_A	138_G	0.589	0.82
45_T	67_T	0.587	0.82
25_M	73_A	0.586	0.82
90_A	95_Q	0.585	0.82
57_R	115_A	0.585	0.82
99_A	102_D	0.584	0.81
111_L	115_A	0.584	0.81
147_R	150_H	0.583	0.81
140_T	144_R	0.582	0.81
9_A	25_M	0.577	0.81
104_A	130_W	0.576	0.81
92_Y	153_L	0.575	0.80
4_L	8_A	0.575	0.80
9_A	127_D	0.574	0.80
71_A	76_L	0.563	0.79
146_Q	154_V	0.558	0.78
46_D	71_A	0.557	0.78
58_N	155_R	0.550	0.77
72_D	78_L	0.546	0.77
43_I	83_I	0.546	0.77
20_R	43_I	0.543	0.77
108_G	112_D	0.543	0.77
76_L	118_T	0.543	0.77
10_C	15_V	0.539	0.76
17_P	39_G	0.537	0.76
26_C	34_E	0.537	0.76
22_L	25_M	0.533	0.75
67_T	70_R	0.533	0.75
73_A	109_G	0.533	0.75
131_R	156_H	0.531	0.75
10_C	39_G	0.526	0.74
107_V	130_W	0.525	0.74
98_I	101_H	0.524	0.74
12_L	143_A	0.523	0.74
130_W	133_E	0.522	0.74
54_G	58_N	0.519	0.73
9_A	23_D	0.518	0.73
23_D	106_L	0.517	0.73
108_G	138_G	0.517	0.73
79_P	119_A	0.516	0.73
101_H	104_A	0.516	0.73
13_A	38_L	0.516	0.73
42_P	59_L	0.515	0.73
26_C	150_H	0.513	0.73
25_M	118_T	0.510	0.72
104_A	108_G	0.509	0.72
144_R	147_R	0.506	0.71
125_V	155_R	0.506	0.71
131_R	141_V	0.505	0.71
94_R	127_D	0.505	0.71
88_L	114_L	0.504	0.71
31_V	34_E	0.500	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ldgA	1	0.9689	100	0.259	Contact Map
3lduA	1	0.9689	100	0.269	Contact Map
3k0bA	1	0.9441	100	0.281	Contact Map
3v97A	1	0.9565	100	0.288	Contact Map
3tm4A	1	0.9441	100	0.364	Contact Map
3tmaA	2	0.9503	100	0.374	Contact Map
3s1sA	1	0.9814	99.8	0.593	Contact Map
3ufbA	1	0.9876	99.8	0.6	Contact Map
3khkA	1	0.9689	99.8	0.607	Contact Map
2ar0A	1	0.9752	99.8	0.608	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.