TBPE - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TBPE - TATA-box-binding protein E

UniProt:	Q9HN56	Sequences: MTDPKETINIENVVASTGIGQELDLQSVAMDLEGADYDPEQFPGLVYRTQDPKSAALIFRSGKIVCTGAKSTDDVHESLRIVFDKLRELSIKVEDDPEIVVQNIVTSADLGRQLNLNAIAIGLGLENIEYEPEQFPGLVYRLDDPEVVALLFGSGKLVITGGKEPKDAEHAVDKITSRLEELGLLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	186 (174)
Sequences:	546 (348)
Seq/√Len:	26.4

HALSA - TBPE TBPD TBPB TBPF TBPC
SULSO - TBP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_L	28_V	5.221	1.00
54_S	69_A	4.356	1.00
59_F	67_T	3.033	1.00
135_F	152_F	3.030	1.00
142_L	145_P	2.996	1.00
35_A	45_L	2.924	1.00
42_F	59_F	2.732	0.99
15_A	75_V	2.539	0.99
54_S	78_S	2.526	0.99
42_F	57_L	2.380	0.99
147_V	171_A	2.355	0.98
44_G	154_S	2.336	0.98
67_T	160_T	2.261	0.98
150_L	158_V	2.218	0.98
12_N	103_N	2.206	0.98
84_D	87_R	2.203	0.98
36_D	48_R	2.048	0.96
46_V	59_F	2.038	0.96
54_S	82_V	2.010	0.96
105_V	158_V	1.964	0.95
142_L	175_I	1.939	0.95
159_I	168_A	1.919	0.95
135_F	150_L	1.891	0.94
80_R	84_D	1.846	0.93
18_G	98_E	1.833	0.93
33_E	40_E	1.825	0.93
149_A	175_I	1.805	0.92
142_L	174_K	1.772	0.92
46_V	57_L	1.711	0.90
13_V	75_V	1.672	0.89
13_V	71_S	1.665	0.89
26_Q	30_M	1.658	0.89
19_I	86_L	1.654	0.89
132_P	155_G	1.642	0.88
102_Q	105_V	1.516	0.84
120_A	138_L	1.449	0.81
42_F	103_N	1.431	0.80
57_L	65_V	1.427	0.80
136_P	152_F	1.417	0.79
47_Y	58_I	1.364	0.77
17_T	64_I	1.356	0.76
47_Y	85_K	1.349	0.76
119_I	149_A	1.333	0.75
110_L	159_I	1.332	0.75
61_S	131_E	1.329	0.75
65_V	107_S	1.295	0.73
45_L	168_A	1.275	0.72
68_G	132_P	1.268	0.71
22_E	60_R	1.247	0.70
149_A	157_L	1.239	0.69
137_G	154_S	1.238	0.69
45_L	126_E	1.207	0.67
15_A	66_C	1.202	0.67
54_S	75_V	1.193	0.66
66_C	175_I	1.185	0.66
105_V	150_L	1.179	0.66
10_I	49_T	1.178	0.65
144_D	170_H	1.168	0.65
50_Q	178_R	1.162	0.64
21_Q	91_I	1.158	0.64
139_V	150_L	1.130	0.62
56_A	82_V	1.128	0.62
109_D	156_K	1.127	0.62
35_A	181_E	1.120	0.61
44_G	59_F	1.111	0.61
42_F	46_V	1.104	0.60
8_I	172_V	1.080	0.59
103_N	160_T	1.079	0.59
154_S	179_L	1.074	0.58
10_I	20_G	1.073	0.58
93_V	151_L	1.060	0.57
34_G	48_R	1.055	0.57
101_V	151_L	1.054	0.57
58_I	136_P	1.046	0.56
68_G	161_G	1.038	0.56
8_I	108_A	1.037	0.55
57_L	150_L	1.032	0.55
19_I	83_F	1.027	0.55
12_N	160_T	1.025	0.55
162_G	171_A	1.023	0.54
41_Q	45_L	1.022	0.54
44_G	57_L	1.013	0.54
114_L	151_L	1.005	0.53
40_E	159_I	1.002	0.53
55_A	59_F	1.002	0.53
159_I	172_V	1.000	0.53
20_G	71_S	0.994	0.52
59_F	65_V	0.987	0.52
24_D	27_S	0.987	0.52
71_S	78_S	0.985	0.52
84_D	178_R	0.981	0.51
117_N	121_I	0.971	0.51
45_L	106_T	0.969	0.50
49_T	107_S	0.962	0.50
89_L	182_L	0.952	0.49
127_N	140_Y	0.937	0.48
104_I	161_G	0.934	0.48
46_V	55_A	0.928	0.47
66_C	75_V	0.920	0.47
11_E	107_S	0.918	0.47
13_V	144_D	0.909	0.46
115_N	153_G	0.906	0.46
27_S	180_E	0.906	0.46
17_T	111_G	0.904	0.46
27_S	31_D	0.903	0.46
15_A	43_P	0.901	0.45
173_D	181_E	0.900	0.45
28_V	36_D	0.892	0.45
14_V	42_F	0.891	0.45
53_K	154_S	0.887	0.44
55_A	79_L	0.886	0.44
131_E	141_R	0.882	0.44
128_I	182_L	0.878	0.44
41_Q	146_E	0.875	0.43
150_L	156_K	0.875	0.43
66_C	69_A	0.874	0.43
29_A	35_A	0.864	0.43
123_L	140_Y	0.851	0.42
49_T	78_S	0.849	0.42
43_P	115_N	0.845	0.41
121_I	126_E	0.844	0.41
10_I	107_S	0.839	0.41
16_S	46_V	0.833	0.40
77_E	81_I	0.833	0.40
20_G	179_L	0.832	0.40
21_Q	95_D	0.829	0.40
120_A	126_E	0.827	0.40
29_A	86_L	0.826	0.40
157_L	177_S	0.821	0.40
9_N	70_K	0.818	0.39
31_D	89_L	0.813	0.39
38_D	113_Q	0.806	0.38
28_V	107_S	0.801	0.38
24_D	113_Q	0.794	0.38
122_G	182_L	0.794	0.38
95_D	177_S	0.787	0.37
108_A	168_A	0.785	0.37
104_I	147_V	0.783	0.37
71_S	111_G	0.782	0.37
61_S	74_D	0.772	0.36
57_L	135_F	0.764	0.36
7_T	169_E	0.762	0.35
81_I	177_S	0.760	0.35
144_D	174_K	0.758	0.35
156_K	163_K	0.758	0.35
22_E	118_A	0.756	0.35
52_P	145_P	0.755	0.35
63_K	103_N	0.749	0.35
43_P	110_L	0.746	0.34
148_V	160_T	0.746	0.34
48_R	102_Q	0.743	0.34
62_G	68_G	0.736	0.34
147_V	162_G	0.731	0.33
81_I	85_K	0.731	0.33
9_N	140_Y	0.730	0.33
137_G	152_F	0.730	0.33
126_E	143_D	0.727	0.33
40_E	115_N	0.724	0.33
169_E	173_D	0.721	0.33
13_V	91_I	0.719	0.33
131_E	161_G	0.717	0.32
123_L	129_E	0.708	0.32
170_H	173_D	0.707	0.32
31_D	38_D	0.707	0.32
75_V	78_S	0.705	0.32
51_D	92_K	0.704	0.32
131_E	137_G	0.696	0.31
19_I	176_T	0.693	0.31
78_S	158_V	0.688	0.31
141_R	154_S	0.684	0.30
67_T	102_Q	0.682	0.30
39_P	119_I	0.677	0.30
178_R	182_L	0.675	0.30
53_K	145_P	0.675	0.30
137_G	162_G	0.670	0.29
119_I	138_L	0.667	0.29
106_T	110_L	0.663	0.29
77_E	95_D	0.660	0.29
123_L	128_I	0.660	0.29
33_E	127_N	0.659	0.29
111_G	177_S	0.657	0.29
21_Q	28_V	0.655	0.29
13_V	157_L	0.649	0.28
132_P	161_G	0.649	0.28
82_V	107_S	0.649	0.28
79_L	108_A	0.648	0.28
11_E	119_I	0.645	0.28
29_A	60_R	0.644	0.28
27_S	181_E	0.643	0.28
102_Q	136_P	0.640	0.28
35_A	172_V	0.634	0.27
48_R	52_P	0.633	0.27
105_V	135_F	0.633	0.27
21_Q	89_L	0.629	0.27
53_K	146_E	0.626	0.27
74_D	164_E	0.625	0.27
63_K	81_I	0.622	0.27
47_Y	55_A	0.618	0.26
129_E	134_Q	0.614	0.26
47_Y	65_V	0.613	0.26
169_E	181_E	0.613	0.26
70_K	163_K	0.611	0.26
35_A	122_G	0.604	0.26
125_L	129_E	0.603	0.25
32_L	118_A	0.594	0.25
38_D	107_S	0.593	0.25
23_L	37_Y	0.592	0.25
8_I	118_A	0.590	0.25
135_F	156_K	0.589	0.25
60_R	107_S	0.587	0.25
61_S	147_V	0.585	0.24
62_G	155_G	0.584	0.24
88_E	95_D	0.581	0.24
71_S	159_I	0.581	0.24
30_M	88_E	0.579	0.24
136_P	140_Y	0.578	0.24
118_A	121_I	0.564	0.23
106_T	168_A	0.562	0.23
141_R	148_V	0.557	0.23
83_F	87_R	0.555	0.23
84_D	94_E	0.555	0.23
24_D	114_L	0.555	0.23
147_V	175_I	0.554	0.23
133_E	155_G	0.553	0.23
156_K	161_G	0.549	0.23
59_F	103_N	0.549	0.23
157_L	176_T	0.547	0.22
148_V	153_G	0.547	0.22
97_P	106_T	0.543	0.22
91_I	95_D	0.538	0.22
14_V	133_E	0.536	0.22
92_K	119_I	0.535	0.22
74_D	173_D	0.534	0.22
31_D	151_L	0.534	0.22
42_F	55_A	0.532	0.22
23_L	119_I	0.531	0.22
120_A	171_A	0.531	0.22
28_V	82_V	0.529	0.22
120_A	125_L	0.528	0.21
104_I	120_A	0.527	0.21
16_S	55_A	0.522	0.21
8_I	75_V	0.521	0.21
65_V	78_S	0.519	0.21
9_N	175_I	0.519	0.21
49_T	59_F	0.518	0.21
19_I	169_E	0.518	0.21
100_V	148_V	0.516	0.21
17_T	128_I	0.516	0.21
89_L	93_V	0.515	0.21
21_Q	82_V	0.515	0.21
18_G	21_Q	0.512	0.21
105_V	139_V	0.507	0.20
30_M	82_V	0.507	0.20
12_N	130_Y	0.503	0.20
16_S	105_V	0.503	0.20
10_I	147_V	0.503	0.20
123_L	127_N	0.502	0.20
58_I	106_T	0.502	0.20
16_S	19_I	0.502	0.20
13_V	101_V	0.500	0.20
136_P	158_V	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rm1A	1	0.9677	100	0.063	Contact Map
4b0aA	1	0.9624	100	0.07	Contact Map
1ytbA	1	0.9677	100	0.074	Contact Map
3eikA	2	0.957	100	0.078	Contact Map
1aisA	1	0.9677	100	0.114	Contact Map
2z8uA	2	0.9462	100	0.115	Contact Map
1mp9A	2	0.9892	100	0.116	Contact Map
2d0bA	1	0.4247	88	0.921	Contact Map
3vn5A	1	0.3763	76.8	0.93	Contact Map
4py5A	1	0.3978	75.5	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.