GMSS - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GMSS - Glutamate mutase sigma subunit

UniProt:	Q9HN21	Sequences: MSATDPTVVLGTIGSDAHAVGITLLDHALREAGFTVHNLGAQTAKTEFATAAADHDADAVLVSSLYGHAQQDCAGLHDQLAAAGVDATTVVGGNLAVGQTDFETVKQRFEEMGFDRVFSAQTGFEAVVDAVKTELDVDERSPTTTTLGA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (128)
Sequences:	245 (159)
Seq/√Len:	14.0

HALSA - GMSS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
118_F	130_A	3.325	0.99
7_T	35_T	2.999	0.97
73_C	91_V	2.954	0.97
11_G	62_V	2.631	0.94
39_L	43_T	2.617	0.94
25_L	124_F	2.505	0.93
25_L	29_L	2.179	0.86
124_F	130_A	2.156	0.85
61_L	127_V	2.057	0.82
46_T	79_Q	2.057	0.82
81_A	85_V	1.972	0.80
77_H	80_L	1.952	0.79
39_L	42_Q	1.927	0.78
106_K	110_E	1.890	0.77
96_A	99_Q	1.847	0.75
45_K	75_G	1.717	0.69
15_S	44_A	1.695	0.68
26_D	30_R	1.689	0.68
60_V	120_A	1.679	0.67
26_D	38_N	1.666	0.67
43_T	48_F	1.658	0.66
60_V	87_A	1.643	0.66
39_L	118_F	1.570	0.62
28_A	32_A	1.543	0.61
49_A	79_Q	1.536	0.60
25_L	32_A	1.536	0.60
13_I	114_F	1.518	0.59
12_T	41_A	1.497	0.58
77_H	89_T	1.484	0.57
29_L	124_F	1.481	0.57
37_H	55_H	1.427	0.54
43_T	69_A	1.410	0.53
44_A	47_E	1.405	0.53
114_F	122_T	1.359	0.51
45_K	73_C	1.322	0.49
52_A	60_V	1.321	0.49
124_F	128_V	1.314	0.48
15_S	42_Q	1.304	0.48
60_V	81_A	1.303	0.48
10_L	124_F	1.299	0.47
127_V	130_A	1.276	0.46
8_V	120_A	1.258	0.45
7_T	37_H	1.256	0.45
63_S	114_F	1.239	0.44
49_A	60_V	1.219	0.43
71_Q	114_F	1.187	0.41
60_V	89_T	1.178	0.41
34_F	59_A	1.174	0.41
10_L	85_V	1.159	0.40
19_A	41_A	1.145	0.39
124_F	127_V	1.145	0.39
20_V	94_N	1.142	0.39
25_L	31_E	1.135	0.39
90_V	116_R	1.126	0.38
7_T	119_S	1.125	0.38
34_F	101_D	1.112	0.38
49_A	82_A	1.104	0.37
88_T	115_D	1.092	0.37
53_A	82_A	1.088	0.36
50_T	121_Q	1.085	0.36
22_I	80_L	1.081	0.36
88_T	131_V	1.080	0.36
81_A	108_R	1.079	0.36
70_Q	131_V	1.075	0.36
91_V	112_M	1.075	0.36
7_T	131_V	1.070	0.35
39_L	102_F	1.062	0.35
14_G	76_L	1.059	0.35
77_H	87_A	1.059	0.35
19_A	31_E	1.023	0.33
23_T	120_A	1.015	0.33
22_I	25_L	0.998	0.32
12_T	124_F	0.986	0.31
107_Q	111_E	0.984	0.31
81_A	84_G	0.976	0.31
74_A	132_K	0.974	0.31
15_S	43_T	0.955	0.30
58_D	104_T	0.954	0.30
107_Q	110_E	0.952	0.30
85_V	108_R	0.949	0.30
91_V	95_L	0.938	0.29
32_A	107_Q	0.935	0.29
84_G	129_D	0.932	0.29
21_G	66_Y	0.928	0.29
32_A	125_E	0.927	0.29
51_A	59_A	0.924	0.29
10_L	15_S	0.915	0.28
9_V	34_F	0.914	0.28
14_G	52_A	0.913	0.28
117_V	125_E	0.912	0.28
37_H	106_K	0.905	0.28
42_Q	66_Y	0.899	0.27
58_D	127_V	0.886	0.27
104_T	107_Q	0.880	0.27
48_F	76_L	0.879	0.27
64_S	78_D	0.877	0.27
86_D	101_D	0.871	0.26
97_V	107_Q	0.857	0.26
26_D	95_L	0.833	0.25
95_L	108_R	0.833	0.25
14_G	75_G	0.832	0.25
8_V	29_L	0.823	0.24
54_D	79_Q	0.814	0.24
6_P	58_D	0.802	0.23
10_L	51_A	0.785	0.23
42_Q	47_E	0.785	0.23
59_A	131_V	0.783	0.23
102_F	106_K	0.783	0.23
23_T	80_L	0.766	0.22
43_T	47_E	0.758	0.22
15_S	27_H	0.757	0.22
103_E	133_T	0.748	0.21
68_H	95_L	0.746	0.21
100_T	107_Q	0.728	0.21
58_D	63_S	0.727	0.21
68_H	117_V	0.723	0.21
12_T	51_A	0.717	0.20
42_Q	90_V	0.716	0.20
41_A	51_A	0.715	0.20
6_P	88_T	0.712	0.20
56_D	121_Q	0.706	0.20
84_G	133_T	0.706	0.20
9_V	41_A	0.704	0.20
69_A	112_M	0.704	0.20
79_Q	83_A	0.691	0.19
7_T	58_D	0.688	0.19
6_P	95_L	0.683	0.19
114_F	118_F	0.677	0.19
32_A	128_V	0.671	0.19
19_A	120_A	0.667	0.19
29_L	32_A	0.663	0.18
69_A	96_A	0.662	0.18
107_Q	115_D	0.659	0.18
35_T	81_A	0.657	0.18
103_E	108_R	0.654	0.18
76_L	80_L	0.653	0.18
69_A	99_Q	0.650	0.18
98_G	122_T	0.649	0.18
17_A	44_A	0.648	0.18
13_I	91_V	0.641	0.18
25_L	80_L	0.634	0.18
46_T	111_E	0.632	0.17
62_V	122_T	0.628	0.17
9_V	86_D	0.622	0.17
128_V	131_V	0.618	0.17
88_T	126_A	0.617	0.17
43_T	121_Q	0.616	0.17
65_L	97_V	0.615	0.17
77_H	99_Q	0.613	0.17
10_L	127_V	0.611	0.17
45_K	69_A	0.611	0.17
35_T	85_V	0.607	0.17
88_T	116_R	0.601	0.17
8_V	89_T	0.599	0.16
66_Y	109_F	0.596	0.16
84_G	102_F	0.589	0.16
79_Q	121_Q	0.589	0.16
29_L	77_H	0.587	0.16
49_A	81_A	0.586	0.16
39_L	130_A	0.585	0.16
7_T	127_V	0.583	0.16
62_V	74_A	0.578	0.16
64_S	98_G	0.577	0.16
48_F	60_V	0.576	0.16
22_I	96_A	0.572	0.16
97_V	115_D	0.568	0.16
17_A	65_L	0.561	0.15
30_R	121_Q	0.561	0.15
17_A	108_R	0.558	0.15
13_I	63_S	0.552	0.15
86_D	98_G	0.552	0.15
11_G	20_V	0.546	0.15
123_G	127_V	0.545	0.15
15_S	88_T	0.542	0.15
72_D	97_V	0.541	0.15
19_A	112_M	0.535	0.15
21_G	112_M	0.530	0.15
27_H	30_R	0.524	0.14
32_A	52_A	0.521	0.14
127_V	131_V	0.520	0.14
70_Q	120_A	0.518	0.14
116_R	132_K	0.516	0.14
13_I	52_A	0.516	0.14
125_E	129_D	0.513	0.14
28_A	128_V	0.512	0.14
32_A	124_F	0.510	0.14
24_L	96_A	0.508	0.14
23_T	94_N	0.502	0.14
101_D	104_T	0.501	0.14
75_G	91_V	0.501	0.14
58_D	129_D	0.500	0.14
25_L	75_G	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1reqA	1	0.906	99.9	0.622	Contact Map
2xijA	2	0.906	99.9	0.626	Contact Map
1xrsB	2	0.8859	99.8	0.645	Contact Map
3kp1A	2	0.8792	99.8	0.65	Contact Map
4r3uC	1	0.8725	99.8	0.669	Contact Map
1reqB	1	0.8859	99.8	0.67	Contact Map
4xc8A	2	0.9732	99.7	0.68	Contact Map
3bulA	1	0.9799	99.7	0.694	Contact Map
3ezxA	2	0.8121	99.7	0.699	Contact Map
2i2xB	1	0.9262	99.7	0.702	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.