Q9HN18 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HN18 - Monoamine oxidase regulatory-like

UniProt:	Q9HN18	Sequences: MPQDTTNPSTGTAEQRTATDTTVQLRAGWQGRFYEDFAVGDVYKHPYGRTVTETDNVWFTNLTMNANPMHFNAAYASGTEFDERLVNGLFVIALSVGMSVVDVSANATANLGYDDIQHHAPVFHGDTLFAESEVLSKRESESRPHVGMVTTELRTYTQDGELVLSLERTPMVRKRGAADPSAARPPGWPAGVGTQPDAERTVPDGESR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (156)
Sequences:	1014 (486)
Seq/√Len:	38.9

ECOLI - PAAZ
BACSU - YDEM
HALSA - Q9HN18 Q9HRM9
SULSO - Q97U86 Q97YZ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
126_D	158_Q	3.611	1.00
120_A	161_E	3.121	1.00
36_D	175_R	3.083	1.00
95_S	155_T	2.980	1.00
50_T	127_T	2.960	1.00
139_E	174_K	2.866	1.00
115_D	167_E	2.784	1.00
32_R	41_D	2.783	1.00
136_S	150_T	2.767	1.00
34_Y	137_K	2.751	1.00
83_E	123_F	2.717	1.00
129_F	160_G	2.678	1.00
133_E	152_E	2.570	1.00
126_D	157_T	2.567	1.00
131_E	154_R	2.428	1.00
133_E	154_R	2.392	1.00
70_H	88_G	2.308	1.00
74_A	77_S	2.210	0.99
82_D	123_F	2.130	0.99
98_M	130_A	2.086	0.99
131_E	156_Y	2.033	0.99
157_T	161_E	2.016	0.99
51_V	90_F	2.011	0.99
35_E	175_R	1.960	0.99
44_K	131_E	1.937	0.98
91_V	155_T	1.908	0.98
90_F	94_L	1.755	0.97
73_A	84_R	1.742	0.97
65_N	87_N	1.665	0.96
49_R	55_D	1.624	0.95
130_A	153_L	1.519	0.93
58_W	61_N	1.436	0.91
63_T	90_F	1.427	0.91
60_T	65_N	1.376	0.89
73_A	77_S	1.369	0.89
89_L	118_H	1.335	0.88
109_A	149_V	1.325	0.88
151_T	170_P	1.324	0.88
152_E	165_S	1.291	0.86
154_R	162_L	1.283	0.86
95_S	130_A	1.250	0.84
67_N	70_H	1.220	0.83
33_F	175_R	1.219	0.83
74_A	82_D	1.215	0.83
53_E	84_R	1.211	0.82
63_T	87_N	1.203	0.82
48_G	129_F	1.200	0.82
53_E	57_V	1.198	0.82
63_T	70_H	1.197	0.82
126_D	163_V	1.196	0.82
140_S	148_M	1.192	0.81
38_A	41_D	1.183	0.81
39_V	137_K	1.178	0.81
140_S	171_M	1.176	0.80
93_A	150_T	1.173	0.80
56_N	64_M	1.173	0.80
51_V	94_L	1.170	0.80
99_S	132_S	1.166	0.80
148_M	171_M	1.162	0.80
39_V	175_R	1.159	0.79
107_A	110_N	1.138	0.78
140_S	144_P	1.111	0.76
56_N	86_V	1.079	0.74
122_V	128_L	1.064	0.73
38_A	83_E	1.045	0.72
65_N	86_V	1.033	0.71
56_N	65_N	1.027	0.71
33_F	176_G	1.011	0.69
114_D	117_Q	1.006	0.69
107_A	151_T	1.003	0.69
80_E	85_L	0.993	0.68
58_W	62_L	0.970	0.66
112_G	117_Q	0.963	0.66
105_A	164_L	0.950	0.65
51_V	86_V	0.943	0.64
116_I	166_L	0.938	0.64
35_E	149_V	0.935	0.63
49_R	88_G	0.932	0.63
35_E	173_R	0.930	0.63
92_I	113_Y	0.926	0.63
93_A	114_D	0.901	0.60
64_M	124_H	0.899	0.60
53_E	58_W	0.893	0.60
42_V	133_E	0.887	0.59
153_L	166_L	0.884	0.59
162_L	165_S	0.873	0.58
176_G	179_D	0.864	0.57
115_D	165_S	0.859	0.57
56_N	124_H	0.858	0.57
63_T	118_H	0.856	0.56
38_A	137_K	0.850	0.56
54_T	127_T	0.844	0.55
81_F	121_P	0.841	0.55
78_G	177_A	0.829	0.54
64_M	96_V	0.825	0.54
89_L	96_V	0.822	0.53
79_T	82_D	0.820	0.53
138_R	148_M	0.820	0.53
157_T	163_V	0.814	0.53
73_A	124_H	0.809	0.52
59_F	87_N	0.809	0.52
100_V	110_N	0.804	0.52
74_A	129_F	0.804	0.52
77_S	161_E	0.803	0.52
97_G	109_A	0.795	0.51
35_E	160_G	0.792	0.51
94_L	128_L	0.790	0.50
37_F	149_V	0.788	0.50
128_L	163_V	0.788	0.50
49_R	90_F	0.780	0.50
173_R	179_D	0.778	0.49
56_N	91_V	0.770	0.49
74_A	78_G	0.769	0.49
84_R	118_H	0.762	0.48
55_D	121_P	0.759	0.48
65_N	70_H	0.753	0.47
65_N	72_N	0.753	0.47
33_F	36_D	0.752	0.47
35_E	174_K	0.750	0.47
129_F	156_Y	0.749	0.47
132_S	168_R	0.748	0.47
60_T	87_N	0.743	0.46
27_A	33_F	0.742	0.46
92_I	96_V	0.737	0.46
140_S	146_V	0.736	0.46
97_G	112_G	0.734	0.45
29_W	43_Y	0.732	0.45
34_Y	147_G	0.729	0.45
59_F	121_P	0.726	0.45
24_Q	38_A	0.725	0.45
99_S	168_R	0.722	0.44
107_A	170_P	0.718	0.44
87_N	90_F	0.715	0.44
73_A	83_E	0.713	0.44
43_Y	154_R	0.708	0.43
128_L	157_T	0.707	0.43
67_N	75_Y	0.706	0.43
97_G	147_G	0.703	0.43
92_I	116_I	0.703	0.43
119_H	162_L	0.703	0.43
87_N	118_H	0.703	0.43
69_M	85_L	0.700	0.42
37_F	104_S	0.700	0.42
42_V	86_V	0.698	0.42
119_H	124_H	0.695	0.42
45_H	155_T	0.693	0.42
132_S	151_T	0.693	0.42
75_Y	79_T	0.692	0.42
31_G	111_L	0.690	0.42
25_L	44_K	0.690	0.42
39_V	178_A	0.684	0.41
40_G	133_E	0.683	0.41
135_L	151_T	0.681	0.41
54_T	57_V	0.676	0.40
119_H	165_S	0.676	0.40
98_M	151_T	0.675	0.40
95_S	164_L	0.674	0.40
43_Y	178_A	0.669	0.40
68_P	75_Y	0.668	0.40
145_H	174_K	0.664	0.39
74_A	156_Y	0.664	0.39
111_L	168_R	0.661	0.39
91_V	128_L	0.660	0.39
64_M	90_F	0.658	0.39
82_D	94_L	0.657	0.39
36_D	71_F	0.657	0.39
34_Y	125_G	0.655	0.38
45_H	48_G	0.652	0.38
91_V	122_V	0.651	0.38
128_L	156_Y	0.650	0.38
60_T	71_F	0.648	0.38
35_E	137_K	0.645	0.38
26_R	44_K	0.643	0.37
53_E	83_E	0.643	0.37
87_N	96_V	0.642	0.37
65_N	118_H	0.640	0.37
132_S	153_L	0.640	0.37
39_V	141_E	0.637	0.37
48_G	127_T	0.630	0.36
122_V	155_T	0.627	0.36
70_H	121_P	0.624	0.36
114_D	122_V	0.624	0.36
38_A	159_D	0.620	0.36
61_N	66_A	0.620	0.36
83_E	124_H	0.619	0.35
158_Q	163_V	0.610	0.35
34_Y	141_E	0.609	0.35
52_T	97_G	0.608	0.35
78_G	104_S	0.606	0.34
28_G	34_Y	0.602	0.34
55_D	105_A	0.601	0.34
112_G	122_V	0.595	0.33
45_H	168_R	0.591	0.33
36_D	50_T	0.589	0.33
119_H	128_L	0.589	0.33
89_L	105_A	0.587	0.33
84_R	124_H	0.586	0.33
83_E	159_D	0.580	0.32
57_V	84_R	0.574	0.32
60_T	70_H	0.574	0.32
76_A	104_S	0.573	0.32
54_T	58_W	0.571	0.32
135_L	167_E	0.571	0.32
110_N	168_R	0.571	0.32
91_V	116_I	0.569	0.31
78_G	136_S	0.567	0.31
61_N	71_F	0.565	0.31
52_T	57_V	0.562	0.31
52_T	136_S	0.561	0.31
78_G	175_R	0.555	0.30
67_N	116_I	0.555	0.30
118_H	164_L	0.553	0.30
115_D	133_E	0.547	0.30
110_N	113_Y	0.537	0.29
61_N	77_S	0.536	0.29
150_T	167_E	0.534	0.29
56_N	70_H	0.531	0.29
138_R	141_E	0.531	0.29
79_T	156_Y	0.530	0.28
101_V	105_A	0.530	0.28
59_F	136_S	0.529	0.28
53_E	124_H	0.529	0.28
78_G	141_E	0.527	0.28
41_D	77_S	0.524	0.28
72_N	84_R	0.524	0.28
148_M	158_Q	0.523	0.28
110_N	170_P	0.522	0.28
47_Y	144_P	0.520	0.28
41_D	137_K	0.519	0.28
92_I	168_R	0.516	0.27
74_A	159_D	0.516	0.27
86_V	173_R	0.509	0.27
37_F	60_T	0.505	0.27
73_A	138_R	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bi0A	3	0.8702	100	0.398	Contact Map
1q6wA	6	0.7115	100	0.409	Contact Map
3exzA	2	0.6971	100	0.419	Contact Map
4e3eA	3	0.8413	100	0.424	Contact Map
4ffuA	6	0.774	100	0.426	Contact Map
3ir3A	2	0.6106	100	0.459	Contact Map
2c2iA	2	0.6875	100	0.47	Contact Map
4rv2B	2	0.6538	100	0.476	Contact Map
3k67A	2	0.7356	100	0.477	Contact Map
1iq6A	2	0.6394	100	0.479	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.