HIS7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIS7 - Imidazoleglycerol-phosphate dehydratase

UniProt:	Q9HN13	Sequences: MTDRTAAVTRETAETDVAVTLDLDGDGEHTVDTGIGFFDHMLAAFAKHGLFDVTVRCDGDLDVDDHHTVEDVGIALGAAFSEAVGEKRGIQRFADRRVPLDEAVASVVVDVSGRAVYEFDGGFSQPTVGGLTSRMAAHFWRTFATHAAVTLHCGVDGENAHHEIEALFKGVGRAVDDATRIDQRRAGETPSTKGDL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	196 (191)
Sequences:	2769 (1366)
Seq/√Len:	98.8

ECOLI - HIS7
BACSU - HIS7
HALSA - HIS7
SULSO - HIS7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_E	16_D	4.074	1.00
80_F	143_F	3.429	1.00
7_A	20_T	3.299	1.00
105_A	166_A	2.901	1.00
30_T	54_T	2.712	1.00
140_W	171_V	2.709	1.00
137_A	158_E	2.684	1.00
153_C	167_L	2.556	1.00
107_V	170_G	2.484	1.00
106_S	154_G	2.431	1.00
16_D	58_D	2.298	1.00
9_T	18_A	2.226	1.00
131_L	136_A	2.183	1.00
81_S	148_A	2.168	1.00
20_T	54_T	2.149	1.00
120_D	154_G	2.092	1.00
57_C	72_V	2.086	1.00
97_R	106_S	2.049	1.00
29_H	46_A	2.027	1.00
128_V	164_I	2.018	1.00
74_I	146_H	2.007	1.00
107_V	153_C	2.001	1.00
57_C	68_T	1.898	1.00
138_H	142_T	1.874	1.00
34_G	39_D	1.869	1.00
25_G	52_D	1.789	1.00
111_V	149_V	1.765	1.00
136_A	164_I	1.763	1.00
38_F	69_V	1.759	1.00
121_G	167_L	1.665	1.00
91_Q	177_D	1.658	1.00
124_S	160_A	1.651	1.00
30_T	56_R	1.651	1.00
91_Q	180_R	1.625	1.00
47_K	192_T	1.614	1.00
137_A	141_R	1.606	1.00
50_L	184_R	1.606	1.00
32_D	56_R	1.587	1.00
143_F	171_V	1.555	1.00
84_V	179_T	1.550	1.00
118_E	156_D	1.533	1.00
27_G	52_D	1.488	1.00
19_V	55_V	1.483	1.00
88_R	187_G	1.453	1.00
7_A	18_A	1.413	1.00
36_G	62_D	1.407	1.00
65_D	135_M	1.392	0.99
38_F	72_V	1.385	0.99
111_V	175_V	1.343	0.99
9_T	16_D	1.339	0.99
123_F	164_I	1.333	0.99
44_A	93_F	1.333	0.99
23_L	179_T	1.331	0.99
90_I	111_V	1.326	0.99
160_A	163_E	1.323	0.99
95_D	177_D	1.317	0.99
78_A	146_H	1.311	0.99
105_A	155_V	1.291	0.99
73_G	138_H	1.286	0.99
69_V	135_M	1.283	0.99
140_W	153_C	1.281	0.99
143_F	149_V	1.279	0.99
127_T	130_G	1.267	0.99
26_D	52_D	1.237	0.99
4_R	24_D	1.234	0.99
34_G	61_L	1.233	0.99
19_V	79_A	1.223	0.99
65_D	132_T	1.213	0.99
18_A	56_R	1.187	0.98
35_I	65_D	1.154	0.98
100_L	108_V	1.153	0.98
134_R	160_A	1.150	0.98
73_G	142_T	1.137	0.98
29_H	43_A	1.131	0.98
48_H	172_G	1.117	0.98
78_A	82_E	1.115	0.98
8_V	75_A	1.114	0.98
155_V	163_E	1.114	0.98
176_D	179_T	1.107	0.97
105_A	163_E	1.100	0.97
97_R	108_V	1.094	0.97
124_S	163_E	1.093	0.97
42_L	53_V	1.093	0.97
13_A	43_A	1.091	0.97
8_V	82_E	1.091	0.97
81_S	87_K	1.086	0.97
125_Q	134_R	1.082	0.97
132_T	135_M	1.081	0.97
5_T	20_T	1.079	0.97
61_L	65_D	1.076	0.97
176_D	180_R	1.069	0.97
107_V	171_V	1.061	0.97
73_G	139_F	1.059	0.97
134_R	159_N	1.044	0.96
95_D	108_V	1.043	0.96
127_T	132_T	1.042	0.96
19_V	75_A	1.036	0.96
121_G	155_V	1.035	0.96
5_T	22_D	1.032	0.96
69_V	131_L	1.018	0.96
105_A	167_L	1.010	0.96
115_A	145_T	1.008	0.95
33_T	39_D	1.007	0.95
65_D	130_G	1.004	0.95
45_F	172_G	0.992	0.95
32_D	58_D	0.973	0.95
33_T	55_V	0.965	0.94
50_L	185_R	0.957	0.94
140_W	167_L	0.954	0.94
61_L	68_T	0.949	0.94
99_P	104_V	0.948	0.94
125_Q	160_A	0.946	0.94
119_F	136_A	0.945	0.94
33_T	72_V	0.944	0.94
50_L	176_D	0.934	0.93
98_V	170_G	0.928	0.93
8_V	79_A	0.919	0.93
153_C	171_V	0.918	0.93
28_E	52_D	0.917	0.93
155_V	166_A	0.911	0.92
141_R	145_T	0.910	0.92
51_F	179_T	0.905	0.92
45_F	175_V	0.905	0.92
103_A	157_G	0.903	0.92
21_L	80_F	0.900	0.92
112_S	150_T	0.898	0.92
31_V	43_A	0.890	0.91
123_F	160_A	0.889	0.91
45_F	49_G	0.885	0.91
44_A	75_A	0.872	0.91
80_F	175_V	0.871	0.91
36_G	130_G	0.870	0.91
19_V	76_L	0.853	0.90
117_Y	144_A	0.850	0.89
119_F	123_F	0.846	0.89
138_H	141_R	0.846	0.89
157_G	163_E	0.845	0.89
38_F	139_F	0.844	0.89
111_V	147_A	0.838	0.89
102_E	150_T	0.837	0.89
144_A	151_L	0.831	0.88
22_D	52_D	0.823	0.88
126_P	160_A	0.823	0.88
34_G	68_T	0.822	0.88
106_S	156_D	0.822	0.88
35_I	61_L	0.821	0.88
45_F	51_F	0.817	0.88
120_D	156_D	0.813	0.87
176_D	184_R	0.803	0.87
65_D	127_T	0.801	0.87
132_T	159_N	0.797	0.86
128_V	160_A	0.792	0.86
32_D	39_D	0.787	0.86
115_A	148_A	0.786	0.85
135_M	138_H	0.782	0.85
84_V	90_I	0.781	0.85
51_F	80_F	0.779	0.85
94_A	174_A	0.778	0.85
142_T	146_H	0.777	0.85
50_L	190_P	0.777	0.85
46_A	49_G	0.772	0.84
121_G	163_E	0.763	0.84
55_V	72_V	0.762	0.84
43_A	62_D	0.757	0.83
103_A	158_E	0.757	0.83
94_A	177_D	0.752	0.83
104_V	108_V	0.747	0.82
36_G	61_L	0.744	0.82
45_F	100_L	0.734	0.81
65_D	128_V	0.729	0.81
46_A	51_F	0.723	0.80
127_T	134_R	0.721	0.80
46_A	53_V	0.721	0.80
125_Q	128_V	0.715	0.80
111_V	150_T	0.713	0.79
116_V	141_R	0.707	0.79
102_E	158_E	0.705	0.79
103_A	155_V	0.703	0.78
96_R	177_D	0.699	0.78
132_T	138_H	0.697	0.78
80_F	149_V	0.697	0.78
21_L	51_F	0.690	0.77
69_V	139_F	0.680	0.76
105_A	156_D	0.677	0.76
36_G	57_C	0.677	0.76
155_V	167_L	0.676	0.76
88_R	189_T	0.671	0.75
128_V	133_S	0.671	0.75
151_L	171_V	0.669	0.75
109_V	151_L	0.669	0.75
35_I	130_G	0.669	0.75
49_G	172_G	0.668	0.75
39_D	62_D	0.667	0.75
117_Y	121_G	0.667	0.75
76_L	143_F	0.664	0.74
39_D	61_L	0.660	0.74
9_T	56_R	0.652	0.73
117_Y	137_A	0.651	0.73
125_Q	133_S	0.651	0.73
117_Y	142_T	0.642	0.72
126_P	132_T	0.639	0.72
91_Q	176_D	0.634	0.71
65_D	136_A	0.631	0.71
97_R	154_G	0.625	0.70
37_F	41_M	0.622	0.70
43_A	47_K	0.622	0.70
180_R	185_R	0.619	0.69
48_H	173_R	0.613	0.68
31_V	39_D	0.613	0.68
189_T	195_D	0.612	0.68
35_I	131_L	0.611	0.68
6_A	82_E	0.611	0.68
8_V	78_A	0.607	0.68
95_D	106_S	0.606	0.68
126_P	133_S	0.604	0.67
87_K	113_G	0.604	0.67
38_F	136_A	0.600	0.67
183_Q	187_G	0.596	0.66
72_V	75_A	0.595	0.66
38_F	73_G	0.593	0.66
85_G	90_I	0.592	0.66
125_Q	132_T	0.586	0.65
161_H	165_E	0.584	0.65
6_A	83_A	0.582	0.64
185_R	190_P	0.579	0.64
115_A	146_H	0.579	0.64
97_R	104_V	0.577	0.64
49_G	176_D	0.576	0.64
44_A	173_R	0.576	0.64
94_A	111_V	0.575	0.64
185_R	189_T	0.574	0.63
6_A	75_A	0.574	0.63
107_V	167_L	0.572	0.63
96_R	173_R	0.571	0.63
119_F	141_R	0.571	0.63
64_D	129_G	0.570	0.63
80_F	109_V	0.567	0.62
29_H	172_G	0.567	0.62
13_A	63_V	0.562	0.62
116_V	137_A	0.561	0.62
19_V	72_V	0.560	0.62
51_F	175_V	0.558	0.61
38_F	75_A	0.557	0.61
87_K	90_I	0.553	0.61
76_L	80_F	0.552	0.60
91_Q	181_I	0.550	0.60
29_H	52_D	0.550	0.60
142_T	145_T	0.548	0.60
13_A	194_G	0.548	0.60
37_F	40_H	0.548	0.60
139_F	143_F	0.546	0.60
152_H	156_D	0.545	0.59
44_A	107_V	0.543	0.59
40_H	161_H	0.543	0.59
92_R	110_D	0.543	0.59
108_V	192_T	0.540	0.59
102_E	152_H	0.539	0.59
108_V	154_G	0.539	0.59
41_M	168_F	0.536	0.58
38_F	42_L	0.535	0.58
66_H	71_D	0.534	0.58
162_H	165_E	0.533	0.58
183_Q	186_A	0.532	0.58
112_S	196_L	0.528	0.57
123_F	126_P	0.527	0.57
133_S	160_A	0.525	0.57
177_D	180_R	0.525	0.57
176_D	185_R	0.524	0.57
63_V	68_T	0.523	0.56
132_T	160_A	0.523	0.56
103_A	166_A	0.521	0.56
118_E	141_R	0.521	0.56
129_G	133_S	0.520	0.56
109_V	192_T	0.516	0.55
98_V	173_R	0.515	0.55
184_R	187_G	0.513	0.55
75_A	79_A	0.512	0.55
115_A	144_A	0.512	0.55
6_A	21_L	0.509	0.54
138_H	158_E	0.509	0.54
44_A	100_L	0.505	0.54
29_H	47_K	0.504	0.54
21_L	53_V	0.504	0.54
23_L	83_A	0.503	0.54
42_L	72_V	0.500	0.53
17_V	57_C	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mu3A	6	0.9337	100	-0.012	Contact Map
4gquA	6	0.9337	100	-0.001	Contact Map
1rhyA	4	0.8929	100	0.001	Contact Map
2ae8A	5	0.8776	100	0.002	Contact Map
4jifA	2	0.4184	31.1	0.96	Contact Map
3p8cA	1	0.3316	8.2	0.969	Contact Map
4pwwA	2	0.2092	7	0.97	Contact Map
2c4wA	2	0.5	6.2	0.971	Contact Map
1sq1A	4	0.1888	5.2	0.972	Contact Map
4ob9A	2	0.2092	5	0.972	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.