Q9HN11 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HN11 - Uncharacterized protein

UniProt:	Q9HN11	Sequences: MQKFEGSPGQQAVIRLLLERGFSVNDGGRVVSGGIEIPYTQVAQEAGVDRRVVDSTTEAILDDGELTRIFQNISQIPSLMDLAPVLDLHVVTVAVQDADEPGIVAAVTGLLADHGIPIRQTISEDPEFTDEPRLYVVTDEELPGAVFTALAEMSAVRSVELS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	162 (159)
Sequences:	120 (82)
Seq/√Len:	6.5

HALSA - Q9HN11

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_V	83_A	4.008	0.95
109_G	136_V	3.449	0.89
111_L	137_V	2.931	0.79
18_L	42_V	2.727	0.74
145_A	149_A	2.553	0.69
91_V	95_V	2.504	0.67
28_G	83_A	2.491	0.67
82_L	87_D	2.190	0.56
17_L	40_T	2.039	0.50
34_G	53_V	2.009	0.49
51_R	120_Q	1.949	0.47
36_E	117_P	1.943	0.47
22_F	30_V	1.929	0.46
61_L	71_Q	1.922	0.46
4_F	8_P	1.893	0.45
51_R	132_P	1.886	0.45
3_K	63_D	1.879	0.45
9_G	46_A	1.850	0.44
49_D	125_D	1.832	0.43
38_P	142_L	1.831	0.43
38_P	56_T	1.827	0.43
94_A	133_R	1.818	0.42
103_I	125_D	1.759	0.40
110_L	152_E	1.713	0.39
120_Q	125_D	1.700	0.38
25_N	86_L	1.696	0.38
7_S	92_T	1.662	0.37
24_V	150_L	1.624	0.36
26_D	57_T	1.590	0.34
14_I	75_Q	1.583	0.34
58_E	150_L	1.518	0.32
48_V	84_P	1.510	0.32
53_V	143_P	1.508	0.32
49_D	120_Q	1.498	0.31
44_Q	139_D	1.451	0.30
91_V	124_E	1.447	0.30
105_A	116_I	1.425	0.29
113_D	149_A	1.420	0.29
49_D	102_G	1.408	0.29
35_I	156_V	1.400	0.28
123_S	134_L	1.394	0.28
56_T	83_A	1.393	0.28
4_F	36_E	1.383	0.28
111_L	136_V	1.382	0.28
70_F	79_L	1.360	0.27
23_S	135_Y	1.356	0.27
69_I	77_P	1.332	0.26
5_E	12_A	1.328	0.26
115_G	136_V	1.319	0.26
114_H	150_L	1.314	0.26
26_D	71_Q	1.294	0.25
37_I	73_I	1.292	0.25
98_A	117_P	1.291	0.25
31_V	92_T	1.276	0.25
37_I	123_S	1.263	0.24
104_V	121_T	1.261	0.24
146_V	156_V	1.242	0.24
56_T	72_N	1.231	0.24
16_L	122_I	1.215	0.23
35_I	52_V	1.198	0.23
113_D	145_A	1.167	0.22
98_A	120_Q	1.167	0.22
102_G	125_D	1.154	0.22
75_Q	121_T	1.148	0.21
146_V	149_A	1.148	0.21
118_I	141_E	1.140	0.21
8_P	90_V	1.139	0.21
37_I	137_V	1.131	0.21
94_A	141_E	1.121	0.21
51_R	91_V	1.115	0.21
112_A	142_L	1.089	0.20
12_A	93_V	1.073	0.20
84_P	123_S	1.067	0.20
26_D	44_Q	1.061	0.19
74_S	105_A	1.050	0.19
32_S	45_E	1.046	0.19
6_G	55_S	1.044	0.19
44_Q	87_D	1.037	0.19
114_H	142_L	1.030	0.19
23_S	39_Y	1.028	0.19
15_R	126_P	1.023	0.18
64_G	147_F	1.019	0.18
39_Y	155_A	1.012	0.18
95_V	110_L	1.011	0.18
38_P	90_V	1.006	0.18
80_M	111_L	1.004	0.18
95_V	157_R	0.988	0.18
28_G	56_T	0.984	0.18
49_D	103_I	0.981	0.18
35_I	141_E	0.963	0.17
91_V	137_V	0.958	0.17
16_L	32_S	0.943	0.17
47_G	109_G	0.938	0.17
9_G	53_V	0.937	0.17
121_T	159_V	0.935	0.17
96_Q	147_F	0.929	0.16
13_V	48_V	0.918	0.16
12_A	91_V	0.914	0.16
15_R	161_L	0.911	0.16
29_R	67_T	0.907	0.16
84_P	88_L	0.905	0.16
120_Q	132_P	0.896	0.16
115_G	143_P	0.895	0.16
14_I	130_D	0.890	0.16
44_Q	72_N	0.868	0.15
42_V	96_Q	0.862	0.15
91_V	159_V	0.857	0.15
64_G	159_V	0.852	0.15
2_Q	101_P	0.852	0.15
10_Q	129_T	0.841	0.15
93_V	107_V	0.836	0.15
61_L	113_D	0.833	0.15
14_I	60_I	0.832	0.15
72_N	94_A	0.831	0.15
23_S	121_T	0.831	0.15
39_Y	67_T	0.831	0.15
131_E	160_E	0.827	0.15
46_A	74_S	0.826	0.15
18_L	52_V	0.821	0.14
149_A	152_E	0.816	0.14
51_R	61_L	0.812	0.14
64_G	71_Q	0.812	0.14
69_I	134_L	0.808	0.14
23_S	107_V	0.794	0.14
17_L	55_S	0.790	0.14
77_P	92_T	0.789	0.14
10_Q	14_I	0.788	0.14
25_N	88_L	0.787	0.14
121_T	138_T	0.785	0.14
79_L	98_A	0.783	0.14
19_E	72_N	0.781	0.14
102_G	120_Q	0.779	0.14
29_R	135_Y	0.774	0.14
16_L	20_R	0.774	0.14
13_V	156_V	0.763	0.13
2_Q	113_D	0.757	0.13
42_V	151_A	0.755	0.13
96_Q	105_A	0.754	0.13
89_H	141_E	0.751	0.13
39_Y	54_D	0.748	0.13
75_Q	92_T	0.748	0.13
76_I	142_L	0.748	0.13
18_L	65_E	0.747	0.13
61_L	67_T	0.747	0.13
7_S	31_V	0.742	0.13
87_D	124_E	0.737	0.13
103_I	120_Q	0.734	0.13
76_I	136_V	0.717	0.13
108_T	142_L	0.716	0.13
40_T	161_L	0.714	0.13
89_H	138_T	0.713	0.13
134_L	153_M	0.713	0.13
23_S	78_S	0.704	0.12
32_S	123_S	0.703	0.12
9_G	60_I	0.700	0.12
78_S	135_Y	0.695	0.12
24_V	130_D	0.695	0.12
15_R	26_D	0.692	0.12
8_P	36_E	0.692	0.12
30_V	130_D	0.690	0.12
88_L	139_D	0.690	0.12
114_H	151_A	0.688	0.12
44_Q	81_D	0.686	0.12
57_T	92_T	0.682	0.12
47_G	87_D	0.680	0.12
47_G	90_V	0.676	0.12
49_D	86_L	0.676	0.12
62_D	161_L	0.673	0.12
40_T	153_M	0.670	0.12
53_V	150_L	0.670	0.12
110_L	158_S	0.668	0.12
9_G	94_A	0.668	0.12
51_R	125_D	0.667	0.12
15_R	62_D	0.667	0.12
74_S	136_V	0.664	0.12
19_E	116_I	0.660	0.12
16_L	84_P	0.657	0.12
118_I	137_V	0.653	0.12
34_G	157_R	0.650	0.12
26_D	34_G	0.649	0.12
47_G	157_R	0.649	0.12
125_D	132_P	0.646	0.12
12_A	86_L	0.635	0.11
9_G	29_R	0.630	0.11
17_L	71_Q	0.629	0.11
23_S	124_E	0.627	0.11
74_S	87_D	0.623	0.11
12_A	58_E	0.623	0.11
24_V	57_T	0.621	0.11
112_A	144_G	0.619	0.11
22_F	57_T	0.617	0.11
13_V	70_F	0.615	0.11
45_E	123_S	0.614	0.11
101_P	111_L	0.613	0.11
73_I	141_E	0.611	0.11
73_I	160_E	0.611	0.11
44_Q	91_V	0.609	0.11
52_V	88_L	0.601	0.11
144_G	156_V	0.598	0.11
83_A	128_F	0.595	0.11
5_E	11_Q	0.595	0.11
10_Q	22_F	0.595	0.11
87_D	91_V	0.591	0.11
19_E	69_I	0.584	0.11
57_T	130_D	0.578	0.11
142_L	152_E	0.576	0.10
20_R	123_S	0.572	0.10
53_V	93_V	0.569	0.10
13_V	84_P	0.569	0.10
26_D	86_L	0.561	0.10
16_L	22_F	0.555	0.10
47_G	85_V	0.555	0.10
19_E	77_P	0.554	0.10
75_Q	152_E	0.551	0.10
105_A	139_D	0.550	0.10
108_T	134_L	0.549	0.10
9_G	70_F	0.543	0.10
93_V	150_L	0.539	0.10
25_N	61_L	0.539	0.10
37_I	157_R	0.535	0.10
64_G	161_L	0.534	0.10
37_I	79_L	0.532	0.10
93_V	152_E	0.531	0.10
24_V	131_E	0.528	0.10
98_A	132_P	0.523	0.10
151_A	156_V	0.522	0.10
108_T	146_V	0.520	0.10
49_D	89_H	0.518	0.10
53_V	115_G	0.516	0.10
117_P	133_R	0.512	0.10
145_A	161_L	0.511	0.10
45_E	102_G	0.511	0.10
49_D	54_D	0.510	0.10
94_A	157_R	0.509	0.10
22_F	54_D	0.506	0.10
105_A	112_A	0.503	0.10
5_E	147_F	0.501	0.10
56_T	61_L	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y7pA	5	0.4691	97.6	0.877	Contact Map
2ko1A	2	0.463	97.2	0.886	Contact Map
2pc6A	2	0.463	97	0.888	Contact Map
2f1fA	4	0.4568	96.7	0.892	Contact Map
1ygyA	4	0.8827	96.6	0.894	Contact Map
2lvwA	2	0.5062	96.2	0.898	Contact Map
2fgcA	2	0.463	95.9	0.901	Contact Map
1zpvA	3	0.4568	95.2	0.906	Contact Map
2cg4A	6	0.8086	95.1	0.906	Contact Map
3louA	3	0.4444	94.5	0.909	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.