UPP - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

UPP - Uracil phosphoribosyltransferase

UniProt:	Q9HN05	Sequences: MTIEDRGDAHVITHSLAKHTLSRLRDTTTEQVSFRKGLVKLGRISGYEIIDGAMETEFTAFETPLTETTGERVTGLDDVVIINVLRAATPFVEGLLKAFPRAKQGVISAGRDEDAGMDADGEFPITVDYVKLPDISEGDTVIVADPMLATGSTMCTVLDHVTDEMPAAGVEDLFVLSAVSAPDGLLRVGDQFPDADLLTVAIDDTLTDDGYIVPGLGDAGDRAFRTT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	227 (204)
Sequences:	3071 (1595)
Seq/√Len:	111.6

ECOLI - UPP
BACSU - UPP
HALSA - UPP
SULSO - UPP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_T	62_E	4.222	1.00
116_G	210_G	4.010	1.00
186_L	190_D	3.832	1.00
180_S	199_T	3.510	1.00
60_A	67_E	3.439	1.00
58_F	69_T	3.344	1.00
22_S	70_G	2.992	1.00
154_M	175_V	2.872	1.00
39_V	97_K	2.854	1.00
185_L	202_I	2.651	1.00
155_C	191_Q	2.634	1.00
155_C	187_R	2.563	1.00
158_L	188_V	2.484	1.00
66_T	204_D	2.483	1.00
32_V	36_K	2.471	1.00
60_A	69_T	2.435	1.00
58_F	71_E	2.341	1.00
57_E	72_R	2.240	1.00
159_D	163_D	2.238	1.00
81_I	144_A	2.197	1.00
187_R	191_Q	2.191	1.00
46_G	95_L	2.181	1.00
182_P	186_L	2.172	1.00
9_A	202_I	2.125	1.00
95_L	176_L	2.004	1.00
62_E	67_E	1.959	1.00
59_T	72_R	1.958	1.00
162_T	192_F	1.901	1.00
30_E	33_S	1.872	1.00
175_V	188_V	1.872	1.00
24_L	38_L	1.806	1.00
18_K	71_E	1.793	1.00
66_T	213_V	1.787	1.00
65_L	213_V	1.783	1.00
17_A	41_L	1.774	1.00
159_D	191_Q	1.742	1.00
11_V	202_I	1.735	1.00
39_V	93_E	1.732	1.00
57_E	74_T	1.725	1.00
186_L	189_G	1.614	1.00
182_P	204_D	1.608	1.00
140_T	172_D	1.605	1.00
207_T	213_V	1.556	1.00
82_I	105_G	1.537	1.00
185_L	197_L	1.534	1.00
42_G	91_F	1.513	1.00
48_E	51_D	1.499	1.00
83_N	89_T	1.484	1.00
53_A	174_F	1.472	1.00
96_L	104_Q	1.468	1.00
61_F	68_T	1.462	1.00
43_R	97_K	1.442	1.00
156_T	159_D	1.425	1.00
20_T	40_K	1.405	1.00
21_L	200_V	1.373	1.00
204_D	213_V	1.333	1.00
49_I	176_L	1.293	0.99
112_D	126_T	1.289	0.99
177_S	199_T	1.287	0.99
81_I	95_L	1.267	0.99
155_C	159_D	1.263	0.99
38_L	178_A	1.250	0.99
205_T	213_V	1.244	0.99
158_L	173_L	1.234	0.99
162_T	194_D	1.219	0.99
174_F	196_D	1.218	0.99
54_M	79_V	1.216	0.99
50_I	99_F	1.208	0.99
130_V	160_H	1.203	0.99
160_H	164_E	1.202	0.99
35_R	96_L	1.197	0.99
29_T	222_R	1.190	0.99
113_E	209_D	1.183	0.99
107_I	157_V	1.177	0.99
110_G	126_T	1.175	0.99
45_S	176_L	1.158	0.99
24_L	37_G	1.158	0.99
78_D	139_D	1.153	0.99
159_D	192_F	1.148	0.99
109_A	153_T	1.138	0.99
105_G	132_L	1.134	0.99
105_G	133_P	1.129	0.98
45_S	49_I	1.128	0.98
80_V	136_S	1.128	0.98
135_I	139_D	1.113	0.98
183_D	205_T	1.089	0.98
79_V	139_D	1.074	0.98
55_E	74_T	1.056	0.98
188_V	197_L	1.054	0.98
41_L	200_V	1.050	0.98
9_A	185_L	1.046	0.97
10_H	198_L	1.046	0.97
182_P	205_T	1.040	0.97
9_A	189_G	1.031	0.97
33_S	36_K	1.029	0.97
130_V	164_E	1.028	0.97
24_L	41_L	1.020	0.97
203_D	212_I	1.016	0.97
80_V	141_V	1.008	0.97
160_H	163_D	1.005	0.97
12_I	17_A	0.993	0.97
82_I	132_L	0.986	0.96
140_T	174_F	0.985	0.96
46_G	94_G	0.981	0.96
23_R	72_R	0.976	0.96
171_E	194_D	0.963	0.96
17_A	44_I	0.961	0.96
50_I	54_M	0.959	0.96
46_G	81_I	0.953	0.96
89_T	106_V	0.939	0.95
43_R	98_A	0.936	0.95
56_T	71_E	0.933	0.95
143_V	161_V	0.928	0.95
158_L	195_A	0.922	0.95
26_D	61_F	0.911	0.94
75_G	78_D	0.906	0.94
13_T	18_K	0.904	0.94
156_T	160_H	0.904	0.94
125_I	152_S	0.900	0.94
155_C	188_V	0.893	0.94
136_S	141_V	0.886	0.94
205_T	208_D	0.881	0.93
59_T	70_G	0.860	0.93
90_P	223_A	0.859	0.93
92_V	106_V	0.853	0.92
20_T	37_G	0.850	0.92
22_S	72_R	0.850	0.92
141_V	170_V	0.844	0.92
143_V	158_L	0.836	0.91
174_F	198_L	0.826	0.91
81_I	99_F	0.825	0.91
49_I	142_I	0.814	0.90
142_I	174_F	0.814	0.90
161_V	170_V	0.813	0.90
46_G	49_I	0.811	0.90
12_I	45_S	0.811	0.90
81_I	92_V	0.808	0.90
172_D	196_D	0.805	0.90
46_G	98_A	0.792	0.89
21_L	179_V	0.791	0.89
111_R	147_M	0.780	0.88
111_R	220_G	0.778	0.88
110_G	129_Y	0.778	0.88
23_R	33_S	0.775	0.88
39_V	43_R	0.769	0.88
187_R	190_D	0.767	0.88
112_D	115_A	0.761	0.87
80_V	105_G	0.748	0.86
116_G	209_D	0.742	0.86
183_D	186_L	0.742	0.86
87_A	147_M	0.736	0.85
147_M	212_I	0.734	0.85
199_T	202_I	0.731	0.85
142_I	176_L	0.724	0.84
92_V	104_Q	0.724	0.84
38_L	41_L	0.720	0.84
111_R	218_D	0.719	0.84
79_V	140_T	0.715	0.84
83_N	144_A	0.714	0.84
189_G	196_D	0.714	0.84
66_T	205_T	0.713	0.83
42_G	94_G	0.712	0.83
29_T	33_S	0.708	0.83
141_V	161_V	0.704	0.83
103_K	139_D	0.703	0.83
63_T	68_T	0.703	0.83
143_V	157_V	0.700	0.82
188_V	195_A	0.700	0.82
22_S	61_F	0.695	0.82
170_V	194_D	0.695	0.82
13_T	51_D	0.694	0.82
162_T	169_G	0.693	0.82
134_D	137_E	0.692	0.82
108_S	128_D	0.686	0.81
12_I	199_T	0.685	0.81
189_G	197_L	0.684	0.81
203_D	214_P	0.684	0.81
23_R	29_T	0.683	0.81
184_G	206_L	0.681	0.81
25_R	203_D	0.675	0.80
38_L	223_A	0.672	0.80
140_T	171_E	0.671	0.80
124_P	187_R	0.671	0.80
10_H	196_D	0.668	0.79
44_I	47_Y	0.668	0.79
21_L	201_A	0.665	0.79
75_G	103_K	0.665	0.79
29_T	64_P	0.664	0.79
89_T	92_V	0.663	0.79
23_R	37_G	0.663	0.79
39_V	42_G	0.657	0.78
147_M	153_T	0.656	0.78
93_E	97_K	0.656	0.78
111_R	146_P	0.653	0.78
177_S	180_S	0.650	0.77
111_R	153_T	0.650	0.77
28_T	62_E	0.649	0.77
38_L	42_G	0.647	0.77
109_A	156_T	0.642	0.77
125_I	156_T	0.641	0.76
61_F	67_E	0.640	0.76
25_R	214_P	0.640	0.76
79_V	99_F	0.639	0.76
110_G	125_I	0.638	0.76
152_S	187_R	0.636	0.76
44_I	98_A	0.634	0.76
80_V	132_L	0.634	0.76
112_D	124_P	0.632	0.75
26_D	59_T	0.630	0.75
109_A	160_H	0.627	0.75
211_Y	219_A	0.627	0.75
38_L	219_A	0.620	0.74
16_L	98_A	0.618	0.74
192_F	195_A	0.617	0.74
111_R	149_A	0.611	0.73
92_V	144_A	0.610	0.73
107_I	130_V	0.609	0.73
124_P	127_V	0.605	0.72
147_M	216_L	0.605	0.72
185_L	189_G	0.605	0.72
46_G	176_L	0.605	0.72
183_D	204_D	0.601	0.72
179_V	201_A	0.597	0.71
40_K	47_Y	0.593	0.71
9_A	180_S	0.591	0.71
124_P	152_S	0.590	0.70
12_I	200_V	0.588	0.70
143_V	188_V	0.587	0.70
158_L	162_T	0.586	0.70
16_L	44_I	0.586	0.70
159_D	187_R	0.583	0.70
109_A	127_V	0.582	0.69
125_I	153_T	0.579	0.69
24_L	49_I	0.579	0.69
64_P	222_R	0.578	0.69
113_E	152_S	0.577	0.69
17_A	200_V	0.576	0.69
203_D	215_G	0.572	0.68
212_I	216_L	0.572	0.68
61_F	70_G	0.570	0.68
214_P	217_G	0.570	0.68
212_I	218_D	0.569	0.68
30_E	101_R	0.566	0.67
34_F	219_A	0.565	0.67
124_P	156_T	0.565	0.67
39_V	46_G	0.564	0.67
87_A	220_G	0.561	0.67
34_F	87_A	0.560	0.66
147_M	211_Y	0.558	0.66
98_A	101_R	0.558	0.66
75_G	139_D	0.555	0.66
107_I	143_V	0.552	0.65
115_A	152_S	0.550	0.65
87_A	219_A	0.547	0.65
33_S	174_F	0.545	0.64
154_M	177_S	0.544	0.64
155_C	192_F	0.544	0.64
49_I	141_V	0.542	0.64
50_I	73_V	0.542	0.64
36_K	97_K	0.542	0.64
211_Y	218_D	0.541	0.64
162_T	173_L	0.537	0.63
80_V	170_V	0.536	0.63
185_L	199_T	0.535	0.63
38_L	91_F	0.533	0.63
18_K	201_A	0.532	0.63
178_A	200_V	0.532	0.63
19_H	73_V	0.532	0.63
196_D	199_T	0.530	0.62
22_S	26_D	0.528	0.62
43_R	46_G	0.528	0.62
20_T	44_I	0.528	0.62
159_D	162_T	0.527	0.62
31_Q	35_R	0.526	0.62
110_G	131_K	0.525	0.61
87_A	211_Y	0.523	0.61
153_T	156_T	0.523	0.61
30_E	103_K	0.523	0.61
18_K	56_T	0.521	0.61
92_V	95_L	0.520	0.61
192_F	197_L	0.520	0.61
39_V	223_A	0.520	0.61
47_Y	94_G	0.520	0.61
47_Y	225_R	0.517	0.60
143_V	173_L	0.517	0.60
64_P	133_P	0.516	0.60
153_T	177_S	0.514	0.60
162_T	195_A	0.512	0.60
193_P	226_T	0.511	0.59
173_L	195_A	0.510	0.59
39_V	199_T	0.510	0.59
111_R	221_D	0.509	0.59
19_H	40_K	0.506	0.59
51_D	98_A	0.506	0.59
146_P	153_T	0.505	0.59
85_L	89_T	0.504	0.58
207_T	212_I	0.504	0.58
87_A	212_I	0.503	0.58
83_N	108_S	0.503	0.58
148_L	180_S	0.502	0.58
59_T	69_T	0.502	0.58
91_F	178_A	0.501	0.58
170_V	195_A	0.500	0.58
183_D	210_G	0.500	0.58
146_P	149_A	0.500	0.58
87_A	149_A	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xttA	3	0.9383	100	0.27	Contact Map
3dmpA	4	0.9339	100	0.3	Contact Map
1bd3D	3	0.9471	100	0.301	Contact Map
2ehjA	3	0.9163	100	0.309	Contact Map
1o5oA	3	0.9251	100	0.315	Contact Map
1v9sA	3	0.9163	100	0.333	Contact Map
2e55A	3	0.9075	100	0.342	Contact Map
1i5eA	2	0.9163	100	0.395	Contact Map
3s5jB	2	0.815	99.8	0.755	Contact Map
1qb7A	2	0.8899	99.7	0.781	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.