Q9HN01 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HN01 - Uncharacterized protein

UniProt:	Q9HN01	Sequences: MSAPAAPPRPPHSDAHITLYRLQACPFCERVVNRLEELGLAYQSRYVEPMHSERDAVKRIVGARTVPAIVDDETGVAMAESANIVAYLDATYGGGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	96 (84)
Sequences:	429 (241)
Seq/√Len:	26.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_R	89_D	3.702	1.00
61_V	79_A	3.566	1.00
17_I	69_I	3.309	1.00
18_T	45_R	2.535	0.99
87_Y	91_T	2.525	0.99
21_R	48_E	2.496	0.99
21_R	44_S	2.287	0.98
30_R	82_A	2.159	0.97
57_V	68_A	1.993	0.95
27_F	80_E	1.923	0.95
35_L	42_Y	1.891	0.94
18_T	72_D	1.729	0.91
68_A	77_A	1.678	0.89
21_R	28_C	1.667	0.89
60_I	77_A	1.587	0.86
54_R	80_E	1.449	0.81
60_I	70_V	1.357	0.76
81_S	93_G	1.297	0.73
18_T	56_A	1.295	0.73
28_C	46_Y	1.290	0.72
70_V	75_G	1.271	0.71
41_A	51_H	1.262	0.71
16_H	73_E	1.208	0.67
44_S	48_E	1.195	0.66
27_F	81_S	1.180	0.65
18_T	70_V	1.158	0.64
29_E	33_N	1.146	0.63
11_P	70_V	1.135	0.62
24_A	63_A	1.131	0.62
76_V	87_Y	1.126	0.62
55_D	59_R	1.121	0.61
20_Y	48_E	1.103	0.60
20_Y	28_C	1.087	0.59
15_A	72_D	1.083	0.59
34_R	85_V	1.070	0.58
27_F	47_V	1.066	0.57
54_R	81_S	1.065	0.57
35_L	44_S	1.032	0.55
83_N	86_A	1.014	0.54
63_A	79_A	1.012	0.53
45_R	56_A	1.009	0.53
15_A	73_E	1.008	0.53
65_T	79_A	0.982	0.51
28_C	44_S	0.974	0.51
38_L	88_L	0.972	0.50
20_Y	64_R	0.966	0.50
29_E	32_V	0.962	0.50
68_A	79_A	0.950	0.49
29_E	49_P	0.935	0.48
84_I	92_Y	0.931	0.47
16_H	72_D	0.923	0.47
55_D	85_V	0.921	0.47
55_D	66_V	0.909	0.46
26_P	47_V	0.902	0.45
48_E	51_H	0.899	0.45
64_R	79_A	0.886	0.44
24_A	30_R	0.883	0.44
25_C	28_C	0.871	0.43
19_L	32_V	0.861	0.42
56_A	59_R	0.859	0.42
21_R	42_Y	0.847	0.41
59_R	78_M	0.819	0.39
25_C	79_A	0.810	0.39
43_Q	57_V	0.806	0.38
82_A	90_A	0.799	0.38
47_V	57_V	0.798	0.38
23_Q	29_E	0.786	0.37
84_I	87_Y	0.786	0.37
22_L	25_C	0.785	0.37
36_E	39_G	0.777	0.36
33_N	46_Y	0.764	0.35
20_Y	45_R	0.762	0.35
39_G	46_Y	0.758	0.35
39_G	90_A	0.757	0.35
22_L	49_P	0.744	0.34
20_Y	70_V	0.733	0.33
21_R	29_E	0.733	0.33
21_R	46_Y	0.733	0.33
22_L	51_H	0.725	0.33
23_Q	90_A	0.717	0.32
71_D	92_Y	0.712	0.32
23_Q	46_Y	0.709	0.32
17_I	35_L	0.707	0.32
55_D	58_K	0.703	0.31
27_F	54_R	0.697	0.31
58_K	62_G	0.686	0.30
26_P	81_S	0.679	0.30
23_Q	56_A	0.678	0.30
41_A	73_E	0.676	0.30
59_R	91_T	0.673	0.30
57_V	66_V	0.663	0.29
11_P	76_V	0.657	0.29
76_V	90_A	0.655	0.28
17_I	43_Q	0.654	0.28
22_L	63_A	0.636	0.27
41_A	53_E	0.636	0.27
87_Y	92_Y	0.635	0.27
86_A	91_T	0.631	0.27
28_C	64_R	0.631	0.27
27_F	49_P	0.630	0.27
35_L	91_T	0.628	0.27
13_S	73_E	0.620	0.26
47_V	53_E	0.613	0.26
37_E	57_V	0.597	0.25
14_D	83_N	0.597	0.25
60_I	85_V	0.589	0.25
56_A	60_I	0.578	0.24
52_S	66_V	0.578	0.24
15_A	70_V	0.570	0.24
33_N	48_E	0.562	0.23
19_L	44_S	0.560	0.23
10_P	35_L	0.551	0.23
19_L	69_I	0.547	0.22
15_A	43_Q	0.545	0.22
54_R	93_G	0.544	0.22
46_Y	53_E	0.540	0.22
13_S	19_L	0.532	0.22
70_V	79_A	0.527	0.21
24_A	45_R	0.527	0.21
19_L	29_E	0.524	0.21
58_K	63_A	0.524	0.21
11_P	14_D	0.518	0.21
11_P	58_K	0.516	0.21
52_S	55_D	0.512	0.21
26_P	80_E	0.503	0.20
22_L	26_P	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3vlnA	2	0.9583	99.3	0.643	Contact Map
3q18A	2	0.9479	99.3	0.644	Contact Map
4agsA	3	0.8646	99.3	0.645	Contact Map
4lmwA	2	0.875	99.3	0.647	Contact Map
4o7hA	2	0.8229	99.3	0.648	Contact Map
3rbtA	2	0.9792	99.3	0.649	Contact Map
4kh7A	2	0.8854	99.3	0.651	Contact Map
3einA	2	0.8125	99.3	0.651	Contact Map
3f6dA	2	0.8229	99.3	0.652	Contact Map
4puaA	2	0.9896	99.3	0.652	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.