Q9HN00 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HN00 - Uncharacterized protein

UniProt:	Q9HN00	Sequences: MELDFDVVDLPAADHVAAGDDAPDFIRPLVTDEYWADVALADLLAEGPVVLVFTPMDGAFPATDMYSELRERGVHERAQVVGVSISTPYEHKTTIKDRGIQEFTGLFSDPQAGVAEAYGVEHDPDGMAGVVEHRPATVVIGADGTVEYAWVAQQWPEFPAYDELEAALDEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (144)
Sequences:	11083 (6495)
Seq/√Len:	541.2

ECOLI - AHPC TPX BCP
BACSU - YKUU AHPC TPX BCP YKUV RESA
HALSA - Q9HN00 Q9HQE6 Q9HP28
SULSO - TDXH Q97VL0 Q97WG5 Q97WP9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_P	142_A	3.174	1.00
26_I	37_D	2.981	1.00
47_G	79_Q	2.956	1.00
57_D	91_H	2.687	1.00
77_R	169_D	2.686	1.00
22_A	118_Y	2.656	1.00
29_L	33_E	2.474	1.00
26_I	39_A	2.332	1.00
141_G	147_E	2.254	1.00
70_R	101_Q	2.221	1.00
28_P	37_D	2.192	1.00
21_D	145_T	2.187	1.00
122_H	134_R	2.081	1.00
17_A	20_D	1.985	1.00
113_G	117_A	1.956	1.00
30_V	95_I	1.953	1.00
85_I	112_A	1.863	1.00
24_D	41_A	1.860	1.00
39_A	42_D	1.743	1.00
141_G	145_T	1.732	1.00
72_R	161_Y	1.657	1.00
115_A	133_H	1.646	1.00
68_E	72_R	1.624	1.00
27_R	114_V	1.617	1.00
85_I	115_A	1.609	1.00
38_V	43_L	1.601	1.00
24_D	39_A	1.580	1.00
148_Y	167_A	1.574	1.00
27_R	107_F	1.558	1.00
58_G	98_R	1.518	1.00
29_L	38_V	1.504	1.00
29_L	105_G	1.471	1.00
75_H	79_Q	1.456	1.00
66_Y	100_I	1.451	1.00
49_V	144_G	1.447	1.00
48_P	78_A	1.428	1.00
50_V	139_V	1.414	1.00
78_A	168_L	1.394	1.00
58_G	93_T	1.387	1.00
73_G	76_E	1.380	1.00
70_R	103_F	1.338	1.00
116_E	121_E	1.322	1.00
49_V	81_V	1.322	1.00
72_R	162_D	1.293	1.00
22_A	140_I	1.291	1.00
112_A	116_E	1.290	1.00
49_V	79_Q	1.287	1.00
28_P	88_P	1.279	1.00
92_K	96_K	1.271	1.00
162_D	166_A	1.270	1.00
43_L	49_V	1.255	1.00
112_A	121_E	1.210	1.00
43_L	81_V	1.205	1.00
67_S	71_E	1.169	1.00
140_I	146_V	1.145	1.00
120_V	138_V	1.141	1.00
64_D	158_F	1.137	1.00
16_V	146_V	1.135	1.00
48_P	147_E	1.128	1.00
52_V	66_Y	1.112	1.00
85_I	133_H	1.110	1.00
89_Y	93_T	1.094	1.00
79_Q	105_G	1.079	1.00
53_F	83_V	1.078	1.00
163_E	166_A	1.070	1.00
24_D	40_L	1.068	1.00
82_G	106_L	1.056	1.00
58_G	97_D	1.050	1.00
120_V	136_A	1.048	1.00
67_S	70_R	1.042	1.00
150_W	167_A	1.028	1.00
18_A	148_Y	1.014	1.00
139_V	167_A	1.013	1.00
147_E	153_Q	1.011	1.00
92_K	95_I	1.006	1.00
68_E	71_E	0.993	1.00
88_P	108_S	0.989	1.00
29_L	107_F	0.985	1.00
136_A	151_V	0.984	1.00
166_A	169_D	0.974	1.00
138_V	146_V	0.966	1.00
134_R	151_V	0.964	1.00
52_V	103_F	0.961	1.00
93_T	96_K	0.955	1.00
31_T	92_K	0.950	1.00
73_G	165_E	0.944	1.00
114_V	118_Y	0.942	1.00
49_V	140_I	0.940	1.00
113_G	116_E	0.939	1.00
87_T	90_E	0.938	1.00
58_G	90_E	0.936	1.00
66_Y	82_G	0.934	1.00
159_P	162_D	0.931	1.00
54_T	82_G	0.928	1.00
73_G	169_D	0.925	1.00
112_A	115_A	0.924	1.00
64_D	67_S	0.922	1.00
69_L	80_V	0.913	1.00
67_S	98_R	0.900	1.00
48_P	168_L	0.897	1.00
30_V	92_K	0.896	1.00
115_A	121_E	0.882	1.00
40_L	49_V	0.876	1.00
83_V	114_V	0.862	1.00
46_E	142_A	0.856	1.00
63_T	98_R	0.853	1.00
18_A	149_A	0.849	1.00
41_A	45_A	0.845	1.00
22_A	146_V	0.844	1.00
139_V	150_W	0.844	1.00
81_V	107_F	0.835	1.00
38_V	81_V	0.829	1.00
50_V	78_A	0.827	1.00
25_F	118_Y	0.811	1.00
150_W	164_L	0.810	1.00
22_A	40_L	0.807	1.00
54_T	57_D	0.802	1.00
50_V	137_T	0.802	1.00
28_P	110_P	0.793	1.00
69_L	164_L	0.780	1.00
150_W	163_E	0.779	1.00
51_L	140_I	0.778	1.00
56_M	86_S	0.775	1.00
45_A	144_G	0.771	1.00
74_V	165_E	0.771	1.00
134_R	152_A	0.771	1.00
25_F	114_V	0.770	1.00
73_G	77_R	0.767	1.00
153_Q	157_E	0.751	1.00
87_T	110_P	0.749	1.00
31_T	95_I	0.749	1.00
22_A	114_V	0.748	1.00
139_V	148_Y	0.741	1.00
65_M	69_L	0.736	1.00
64_D	68_E	0.735	1.00
43_L	79_Q	0.731	1.00
148_Y	163_E	0.730	1.00
53_F	120_V	0.729	1.00
51_L	118_Y	0.712	1.00
18_A	146_V	0.710	1.00
159_P	163_E	0.709	1.00
137_T	164_L	0.708	1.00
85_I	109_D	0.694	1.00
30_V	88_P	0.694	1.00
124_P	132_E	0.685	1.00
109_D	112_A	0.681	1.00
165_E	169_D	0.679	1.00
17_A	149_A	0.676	1.00
140_I	144_G	0.675	1.00
40_L	43_L	0.667	1.00
77_R	168_L	0.664	1.00
54_T	91_H	0.650	1.00
50_V	164_L	0.647	1.00
59_A	135_P	0.643	1.00
90_E	93_T	0.643	1.00
52_V	65_M	0.642	1.00
80_V	103_F	0.629	1.00
25_F	40_L	0.628	1.00
52_V	82_G	0.623	1.00
122_H	125_D	0.621	1.00
53_F	118_Y	0.620	1.00
55_P	59_A	0.619	1.00
68_E	161_Y	0.614	1.00
23_P	117_A	0.607	1.00
16_V	20_D	0.599	1.00
74_V	78_A	0.595	1.00
91_H	106_L	0.590	1.00
61_P	156_P	0.590	1.00
150_W	160_A	0.587	1.00
156_P	159_P	0.580	0.99
146_V	149_A	0.577	0.99
101_Q	105_G	0.574	0.99
78_A	139_V	0.574	0.99
30_V	105_G	0.572	0.99
124_P	127_M	0.571	0.99
45_A	143_D	0.566	0.99
85_I	121_E	0.565	0.99
136_A	149_A	0.563	0.99
20_D	149_A	0.562	0.99
77_R	165_E	0.561	0.99
50_V	168_L	0.561	0.99
61_P	157_E	0.559	0.99
147_E	167_A	0.556	0.99
122_H	155_W	0.555	0.99
114_V	117_A	0.553	0.99
139_V	168_L	0.552	0.99
60_F	64_D	0.547	0.99
56_M	87_T	0.547	0.99
66_Y	103_F	0.543	0.99
89_Y	92_K	0.540	0.99
38_V	107_F	0.539	0.99
68_E	162_D	0.538	0.99
54_T	94_T	0.534	0.99
31_T	105_G	0.533	0.99
38_V	42_D	0.532	0.99
24_D	45_A	0.531	0.99
57_D	90_E	0.530	0.99
69_L	161_Y	0.529	0.99
121_E	132_E	0.529	0.99
48_P	141_G	0.527	0.99
33_E	37_D	0.526	0.99
21_D	45_A	0.526	0.99
56_M	59_A	0.525	0.99
106_L	109_D	0.521	0.99
95_I	99_G	0.520	0.99
88_P	92_K	0.519	0.99
160_A	163_E	0.519	0.99
118_Y	140_I	0.513	0.99
134_R	155_W	0.511	0.99
22_A	49_V	0.509	0.99
47_G	75_H	0.508	0.99
29_L	88_P	0.508	0.99
43_L	105_G	0.504	0.98
30_V	33_E	0.504	0.98
40_L	118_Y	0.503	0.98
21_D	24_D	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2v2gA	2	0.8713	100	0.371	Contact Map
3a2vA	5	0.8713	100	0.371	Contact Map
1prxA	2	0.8889	100	0.375	Contact Map
3w6gA	6	0.8421	100	0.377	Contact Map
1xiyA	1	0.883	100	0.379	Contact Map
1xccA	2	0.8772	100	0.379	Contact Map
1xvwA	3	0.8889	100	0.424	Contact Map
3kebA	2	0.9415	100	0.429	Contact Map
3p7xA	3	0.9357	100	0.431	Contact Map
1q98A	2	0.9357	100	0.434	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.