Q9HMZ5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMZ5 - Uncharacterized protein

UniProt:	Q9HMZ5	Sequences: MQTETDGVELVGDQTVENIARAAVFAALTGAMAYVSFQNPVSPAPVTLQVLGVFLAGLYLGPVWGGASMVLYLIAGGVGAPVFAGGGSGLGTFVAPTGGYLLSYPFAAALTGLVAHGTTELADPRDVGVAKLVAAMVAATVVIYAAGTVGFAIVQRPSLAAAFAPSALVDAFLVAGAAFIPAEAFKIAAAIGITRSDQLNAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	202 (170)
Sequences:	2705 (2132)
Seq/√Len:	163.5

BACSU - BIOYB BIOY
HALSA - Q9HMZ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_T	69_M	4.071	1.00
73_L	101_L	3.138	1.00
76_G	83_F	3.117	1.00
32_M	52_G	3.028	1.00
62_P	116_H	2.861	1.00
61_G	112_G	2.700	1.00
151_F	175_A	2.652	1.00
22_A	64_W	2.589	1.00
18_N	64_W	2.514	1.00
152_A	159_L	2.318	1.00
61_G	65_G	2.300	1.00
58_L	136_M	2.235	1.00
107_A	143_I	2.231	1.00
66_G	105_P	2.185	1.00
110_L	142_V	2.164	1.00
58_L	194_T	2.036	1.00
25_F	56_A	1.897	1.00
30_G	82_V	1.896	1.00
114_V	135_A	1.887	1.00
148_T	176_G	1.877	1.00
70_V	105_P	1.862	1.00
172_F	177_A	1.802	1.00
173_L	177_A	1.783	1.00
73_L	105_P	1.761	1.00
98_G	150_G	1.748	1.00
75_A	80_A	1.737	1.00
66_G	109_A	1.732	1.00
47_T	50_V	1.720	1.00
33_A	72_Y	1.698	1.00
144_Y	183_E	1.685	1.00
103_S	146_A	1.657	1.00
39_N	42_S	1.656	1.00
26_A	71_L	1.655	1.00
49_Q	104_Y	1.634	1.00
106_F	146_A	1.544	1.00
170_D	174_V	1.510	1.00
180_I	184_A	1.474	1.00
26_A	68_S	1.449	1.00
95_A	98_G	1.445	1.00
87_G	92_T	1.444	1.00
34_Y	86_G	1.437	1.00
62_P	109_A	1.432	1.00
103_S	143_I	1.409	1.00
144_Y	176_G	1.399	1.00
76_G	82_V	1.393	1.00
65_G	112_G	1.387	1.00
26_A	75_A	1.387	1.00
128_G	131_K	1.377	1.00
29_T	56_A	1.363	1.00
129_V	133_V	1.348	1.00
146_A	149_V	1.345	1.00
26_A	30_G	1.344	1.00
177_A	181_P	1.294	1.00
148_T	171_A	1.282	1.00
67_A	70_V	1.270	1.00
16_V	20_A	1.264	1.00
137_V	187_I	1.220	1.00
140_T	144_Y	1.216	1.00
47_T	104_Y	1.182	1.00
58_L	115_A	1.155	1.00
151_F	155_Q	1.144	1.00
100_Y	175_A	1.127	1.00
72_Y	83_F	1.125	1.00
184_A	188_A	1.118	1.00
77_G	90_L	1.113	1.00
150_G	154_V	1.106	1.00
29_T	53_V	1.104	1.00
73_L	93_F	1.102	1.00
150_G	153_I	1.101	1.00
51_L	190_A	1.101	1.00
151_F	157_P	1.100	1.00
37_F	40_P	1.092	1.00
178_A	181_P	1.089	1.00
69_M	108_A	1.064	0.99
111_T	139_A	1.063	0.99
106_F	142_V	1.060	0.99
57_G	65_G	1.059	0.99
145_A	149_V	1.052	0.99
62_P	112_G	1.047	0.99
56_A	60_L	1.028	0.99
72_Y	104_Y	1.025	0.99
72_Y	76_G	1.018	0.99
60_L	68_S	1.017	0.99
111_T	135_A	1.013	0.99
51_L	189_A	1.009	0.99
46_V	182_A	1.009	0.99
28_L	52_G	0.997	0.99
63_V	116_H	0.990	0.99
75_A	82_V	0.986	0.99
109_A	113_L	0.985	0.99
77_G	88_S	0.973	0.99
62_P	113_L	0.969	0.99
136_M	191_I	0.968	0.99
182_A	186_K	0.967	0.99
64_W	68_S	0.966	0.99
100_Y	151_F	0.965	0.99
148_T	172_F	0.963	0.99
100_Y	143_I	0.958	0.99
133_V	191_I	0.948	0.99
38_Q	42_S	0.945	0.99
98_G	102_L	0.939	0.99
140_T	187_I	0.934	0.99
29_T	52_G	0.933	0.99
21_R	64_W	0.930	0.98
61_G	64_W	0.923	0.98
179_F	186_K	0.922	0.98
48_L	51_L	0.921	0.98
56_A	69_M	0.915	0.98
25_F	60_L	0.905	0.98
90_L	94_V	0.894	0.98
136_M	187_I	0.892	0.98
16_V	19_I	0.890	0.98
54_F	111_T	0.885	0.98
113_L	117_G	0.885	0.98
100_Y	176_G	0.881	0.98
56_A	68_S	0.880	0.98
103_S	107_A	0.877	0.98
106_F	110_L	0.875	0.98
54_F	140_T	0.870	0.98
149_V	152_A	0.861	0.98
77_G	98_G	0.861	0.98
19_I	23_A	0.860	0.97
50_V	140_T	0.856	0.97
134_A	138_A	0.846	0.97
93_F	101_L	0.840	0.97
187_I	191_I	0.829	0.97
50_V	143_I	0.824	0.97
118_T	131_K	0.822	0.97
114_V	138_A	0.818	0.97
191_I	195_R	0.813	0.96
22_A	67_A	0.807	0.96
131_K	134_A	0.803	0.96
103_S	142_V	0.785	0.96
85_G	95_A	0.774	0.95
154_V	158_S	0.773	0.95
53_V	108_A	0.769	0.95
100_Y	144_Y	0.767	0.95
152_A	158_S	0.767	0.95
152_A	171_A	0.763	0.95
66_G	69_M	0.762	0.95
102_L	150_G	0.758	0.95
79_G	89_G	0.754	0.95
54_F	143_I	0.752	0.95
25_F	68_S	0.744	0.94
102_L	106_F	0.743	0.94
50_V	182_A	0.735	0.94
196_S	199_L	0.733	0.94
133_V	188_A	0.729	0.94
130_A	134_A	0.729	0.94
102_L	146_A	0.726	0.94
94_V	98_G	0.706	0.93
140_T	183_E	0.704	0.92
84_A	87_G	0.704	0.92
106_F	109_A	0.702	0.92
14_Q	18_N	0.695	0.92
127_V	131_K	0.691	0.92
129_V	191_I	0.688	0.92
23_A	27_A	0.684	0.91
174_V	178_A	0.678	0.91
25_F	59_Y	0.678	0.91
27_A	75_A	0.677	0.91
22_A	26_A	0.676	0.91
146_A	150_G	0.676	0.91
32_M	35_V	0.675	0.91
93_F	98_G	0.675	0.91
137_V	184_A	0.674	0.91
18_N	22_A	0.669	0.90
192_G	196_S	0.669	0.90
66_G	108_A	0.667	0.90
20_A	24_V	0.666	0.90
114_V	139_A	0.659	0.90
108_A	112_G	0.658	0.90
89_G	98_G	0.656	0.90
132_L	191_I	0.650	0.89
29_T	32_M	0.650	0.89
176_G	180_I	0.649	0.89
133_V	137_V	0.649	0.89
142_V	146_A	0.646	0.89
54_F	107_A	0.642	0.89
107_A	142_V	0.641	0.88
92_T	95_A	0.638	0.88
149_V	153_I	0.636	0.88
38_Q	41_V	0.635	0.88
57_G	111_T	0.631	0.88
119_T	131_K	0.631	0.88
195_R	198_Q	0.631	0.88
66_G	106_F	0.628	0.87
112_G	115_A	0.626	0.87
144_Y	148_T	0.623	0.87
30_G	34_Y	0.622	0.87
113_L	116_H	0.621	0.87
188_A	192_G	0.618	0.87
44_A	97_T	0.615	0.86
97_T	101_L	0.613	0.86
28_L	32_M	0.613	0.86
110_L	138_A	0.612	0.86
30_G	80_A	0.610	0.86
30_G	75_A	0.609	0.86
59_Y	197_D	0.608	0.86
50_V	53_V	0.607	0.86
72_Y	82_V	0.602	0.85
93_F	102_L	0.601	0.85
14_Q	17_E	0.598	0.85
37_F	46_V	0.590	0.84
53_V	57_G	0.588	0.84
44_A	179_F	0.588	0.84
132_L	136_M	0.587	0.84
45_P	151_F	0.587	0.84
157_P	172_F	0.586	0.84
193_I	197_D	0.585	0.83
58_L	191_I	0.582	0.83
23_A	71_L	0.580	0.83
111_T	136_M	0.580	0.83
156_R	160_A	0.578	0.83
18_N	21_R	0.578	0.83
39_N	43_P	0.575	0.82
158_S	170_D	0.574	0.82
112_G	116_H	0.571	0.82
129_V	192_G	0.571	0.82
152_A	156_R	0.569	0.82
45_P	84_A	0.566	0.81
133_V	187_I	0.563	0.81
46_V	181_P	0.560	0.81
44_A	151_F	0.556	0.80
181_P	184_A	0.552	0.80
141_V	145_A	0.550	0.80
17_E	21_R	0.549	0.79
51_L	193_I	0.548	0.79
33_A	84_A	0.548	0.79
114_V	131_K	0.545	0.79
104_Y	143_I	0.542	0.79
148_T	175_A	0.539	0.78
97_T	178_A	0.539	0.78
104_Y	108_A	0.536	0.78
77_G	102_L	0.536	0.78
87_G	90_L	0.532	0.77
59_Y	194_T	0.531	0.77
77_G	93_F	0.529	0.77
98_G	158_S	0.525	0.76
127_V	132_L	0.525	0.76
29_T	68_S	0.523	0.76
30_G	72_Y	0.522	0.76
187_I	190_A	0.519	0.76
135_A	138_A	0.518	0.75
155_Q	159_L	0.516	0.75
29_T	72_Y	0.512	0.75
50_V	186_K	0.512	0.75
62_P	117_G	0.509	0.74
129_V	195_R	0.508	0.74
57_G	66_G	0.506	0.74
170_D	173_L	0.506	0.74
32_M	48_L	0.506	0.74
172_F	176_G	0.501	0.73
140_T	184_A	0.500	0.73
72_Y	101_L	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4dveA	3	0.901	100	0.291	Contact Map
3p5nA	2	0.797	99.9	0.594	Contact Map
4z7fA	2	0.7772	99.8	0.612	Contact Map
4tkrA	2	0.8861	99.8	0.619	Contact Map
4huqS	1	0.7822	99.8	0.626	Contact Map
3rlbA	1	0.8366	99.8	0.636	Contact Map
4hzuS	1	0.7673	99.8	0.644	Contact Map
4rfsS	1	0.8515	99.6	0.696	Contact Map
4m5bA	1	0.896	91.8	0.9	Contact Map
2ksfA	1	0.5	12.6	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.