Q9HMZ2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMZ2 - Putative acetyltransferase

UniProt:	Q9HMZ2	Sequences: MPGPAFADGDAVSLHPIEDEDHEFIQYGRNQPDVRVPLTDTDIRTLDDVAESVEDSDDRFLICVDDRGDSTDEPASSDADNPTPVGEVAFAWVSQAGEHGSLMYWIAPDHQGNGYVTEATTLFLDYVFGERGFHRVDAHVLAPNEASQAALEKLGFEREGQRRDDAIVDGEYVDTYTYGLLDHEWLDD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	188 (166)
Sequences:	19979 (15174)
Seq/√Len:	1177.7

ECOLI - RIMJ ATDA RIML YHHY MNAT
BACSU - YJCK YDAF YOKL YOAA YNAD YKKB YJDG YWNH
HALSA - Q9HMZ2 Q9HNJ3 Q9HRY6 Q9HRY5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
138_A	151_L	2.762	1.00
117_T	153_K	2.722	1.00
15_H	21_D	2.373	1.00
15_H	77_S	2.368	1.00
159_E	179_G	2.312	1.00
33_D	108_P	2.301	1.00
100_G	133_F	2.236	1.00
11_A	118_E	2.201	1.00
90_F	127_V	2.180	1.00
140_V	148_Q	2.157	1.00
158_R	161_Q	2.144	1.00
78_D	81_N	2.109	1.00
8_D	79_A	2.076	1.00
158_R	176_Y	2.071	1.00
9_G	122_L	2.043	1.00
140_V	151_L	2.037	1.00
9_G	118_E	2.008	1.00
149_A	152_E	1.926	1.00
148_Q	152_E	1.925	1.00
125_D	129_G	1.825	1.00
102_L	120_T	1.801	1.00
23_E	46_L	1.793	1.00
124_L	156_F	1.758	1.00
31_Q	108_P	1.743	1.00
124_L	136_V	1.706	1.00
134_H	164_D	1.683	1.00
161_Q	176_Y	1.660	1.00
22_H	50_A	1.649	1.00
24_F	84_P	1.637	1.00
46_L	50_A	1.611	1.00
120_T	154_L	1.600	1.00
88_V	119_A	1.599	1.00
148_Q	158_R	1.546	1.00
75_A	84_P	1.544	1.00
148_Q	176_Y	1.541	1.00
122_L	125_D	1.523	1.00
106_I	116_V	1.509	1.00
167_I	172_Y	1.503	1.00
13_S	79_A	1.481	1.00
142_A	174_D	1.470	1.00
17_I	75_A	1.449	1.00
107_A	110_H	1.442	1.00
45_T	48_D	1.440	1.00
152_E	158_R	1.413	1.00
19_D	54_E	1.410	1.00
104_Y	151_L	1.408	1.00
145_E	148_Q	1.405	1.00
52_S	56_S	1.347	1.00
7_A	122_L	1.345	1.00
8_D	13_S	1.344	1.00
134_H	172_Y	1.340	1.00
117_T	150_A	1.323	1.00
77_S	82_P	1.322	1.00
88_V	123_F	1.315	1.00
135_R	179_G	1.282	1.00
126_Y	130_E	1.264	1.00
148_Q	178_Y	1.257	1.00
85_V	110_H	1.257	1.00
142_A	161_Q	1.254	1.00
165_D	175_T	1.240	1.00
24_F	83_T	1.236	1.00
162_R	177_T	1.193	1.00
127_V	136_V	1.187	1.00
143_P	173_V	1.172	1.00
104_Y	147_S	1.170	1.00
26_Q	46_L	1.162	1.00
116_V	150_A	1.156	1.00
28_G	107_A	1.146	1.00
22_H	53_V	1.143	1.00
83_T	109_D	1.105	1.00
76_S	106_I	1.086	1.00
87_E	105_W	1.084	1.00
7_A	126_Y	1.077	1.00
127_V	131_R	1.072	1.00
22_H	46_L	1.070	1.00
83_T	110_H	1.070	1.00
101_S	139_H	1.063	1.00
50_A	54_E	1.060	1.00
9_G	12_V	1.057	1.00
78_D	85_V	1.054	1.00
140_V	178_Y	1.053	1.00
94_S	97_G	1.052	1.00
111_Q	146_A	1.045	1.00
34_V	111_Q	1.028	1.00
161_Q	174_D	1.025	1.00
163_R	174_D	1.022	1.00
28_G	105_W	1.019	1.00
138_A	156_F	1.018	1.00
24_F	27_Y	1.018	1.00
51_E	55_D	1.016	1.00
19_D	50_A	1.015	1.00
7_A	14_L	1.012	1.00
108_P	111_Q	1.008	1.00
33_D	36_V	1.002	1.00
124_L	180_L	0.989	1.00
135_R	159_E	0.989	1.00
126_Y	131_R	0.987	1.00
147_S	151_L	0.985	1.00
117_T	121_T	0.967	1.00
158_R	178_Y	0.961	1.00
164_D	174_D	0.952	1.00
99_H	137_D	0.952	1.00
74_P	123_F	0.938	1.00
150_A	154_L	0.937	1.00
76_S	119_A	0.930	1.00
151_L	156_F	0.926	1.00
19_D	57_D	0.920	1.00
124_L	154_L	0.919	1.00
163_R	179_G	0.918	1.00
44_R	48_D	0.914	1.00
17_I	87_E	0.913	1.00
43_I	49_V	0.911	1.00
141_L	173_V	0.901	1.00
13_S	77_S	0.887	1.00
90_F	123_F	0.887	1.00
13_S	82_P	0.884	1.00
145_E	149_A	0.884	1.00
78_D	115_Y	0.876	1.00
142_A	176_Y	0.875	1.00
121_T	125_D	0.872	1.00
127_V	133_F	0.868	1.00
33_D	111_Q	0.866	1.00
99_H	135_R	0.865	1.00
156_F	180_L	0.862	1.00
12_V	115_Y	0.860	1.00
117_T	154_L	0.854	1.00
112_G	146_A	0.852	1.00
104_Y	116_V	0.836	1.00
12_V	119_A	0.835	1.00
19_D	22_H	0.822	1.00
162_R	165_D	0.820	1.00
98_E	172_Y	0.820	1.00
121_T	154_L	0.819	1.00
118_E	122_L	0.817	1.00
26_Q	49_V	0.816	1.00
35_R	38_L	0.808	1.00
106_I	115_Y	0.806	1.00
101_S	137_D	0.797	1.00
98_E	167_I	0.795	1.00
47_D	50_A	0.791	1.00
22_H	26_Q	0.782	1.00
77_S	84_P	0.771	1.00
163_R	181_L	0.770	1.00
99_H	165_D	0.768	1.00
23_E	27_Y	0.768	1.00
74_P	126_Y	0.768	1.00
37_P	141_L	0.767	1.00
78_D	110_H	0.765	1.00
29_R	105_W	0.762	1.00
145_E	152_E	0.761	1.00
51_E	54_E	0.759	1.00
110_H	113_N	0.756	1.00
27_Y	107_A	0.753	1.00
21_D	77_S	0.751	1.00
135_R	181_L	0.749	1.00
152_E	178_Y	0.746	1.00
104_Y	120_T	0.740	1.00
31_Q	107_A	0.727	1.00
139_H	162_R	0.726	1.00
54_E	58_D	0.725	1.00
78_D	83_T	0.720	1.00
83_T	107_A	0.718	1.00
167_I	171_E	0.717	1.00
140_V	147_S	0.712	1.00
26_Q	30_N	0.710	1.00
78_D	113_N	0.708	1.00
9_G	14_L	0.707	1.00
112_G	117_T	0.706	1.00
37_P	143_P	0.703	1.00
27_Y	83_T	0.699	1.00
47_D	51_E	0.698	1.00
48_D	51_E	0.695	1.00
27_Y	109_D	0.693	1.00
24_F	107_A	0.693	1.00
120_T	150_A	0.691	1.00
164_D	172_Y	0.691	1.00
159_E	163_R	0.672	1.00
139_H	175_T	0.669	1.00
140_V	176_Y	0.665	1.00
55_D	58_D	0.664	1.00
106_I	111_Q	0.661	1.00
104_Y	150_A	0.656	1.00
35_R	40_D	0.647	1.00
11_A	114_G	0.643	1.00
10_D	118_E	0.639	1.00
112_G	149_A	0.636	1.00
149_A	153_K	0.632	1.00
28_G	84_P	0.632	1.00
15_H	75_A	0.628	1.00
138_A	147_S	0.627	1.00
146_A	149_A	0.622	1.00
168_V	171_E	0.621	1.00
117_T	146_A	0.620	1.00
58_D	68_G	0.620	1.00
15_H	18_E	0.615	1.00
56_S	73_E	0.615	1.00
116_V	120_T	0.609	1.00
143_P	171_E	0.609	1.00
69_D	72_D	0.607	1.00
31_Q	111_Q	0.602	1.00
115_Y	118_E	0.599	1.00
98_E	134_H	0.595	1.00
44_R	49_V	0.591	1.00
88_V	120_T	0.591	1.00
12_V	118_E	0.590	1.00
84_P	87_E	0.589	1.00
85_V	115_Y	0.588	1.00
142_A	148_Q	0.582	1.00
16_P	57_D	0.580	1.00
90_F	100_G	0.580	1.00
32_P	36_V	0.574	1.00
164_D	181_L	0.574	1.00
166_A	175_T	0.573	1.00
139_H	177_T	0.572	1.00
49_V	53_V	0.572	1.00
154_L	180_L	0.570	1.00
151_L	178_Y	0.570	1.00
100_G	127_V	0.564	1.00
93_V	100_G	0.563	1.00
138_A	178_Y	0.560	1.00
91_A	101_S	0.556	1.00
31_Q	109_D	0.553	1.00
124_L	128_F	0.553	1.00
168_V	173_V	0.552	1.00
167_I	170_G	0.551	1.00
53_V	57_D	0.550	1.00
112_G	150_A	0.546	1.00
137_D	165_D	0.545	1.00
104_Y	138_A	0.544	1.00
38_L	105_W	0.543	1.00
137_D	162_R	0.542	1.00
75_A	78_D	0.542	1.00
34_V	105_W	0.541	1.00
157_E	163_R	0.540	1.00
100_G	136_V	0.540	1.00
74_P	77_S	0.538	1.00
106_I	110_H	0.537	1.00
25_I	29_R	0.528	1.00
92_W	100_G	0.528	1.00
135_R	165_D	0.527	1.00
106_I	119_A	0.524	1.00
73_E	89_A	0.522	1.00
23_E	26_Q	0.519	1.00
29_R	87_E	0.510	1.00
76_S	88_V	0.510	1.00
102_L	136_V	0.510	1.00
18_E	21_D	0.506	1.00
27_Y	30_N	0.506	1.00
25_I	87_E	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pzjA	2	0.9415	100	0.288	Contact Map
2fckA	2	0.9202	100	0.307	Contact Map
1yreA	2	0.9149	100	0.309	Contact Map
2vzyA	3	0.883	100	0.317	Contact Map
3r9fA	1	0.9096	100	0.333	Contact Map
2z10A	2	0.9362	100	0.334	Contact Map
3tcvA	2	0.9521	100	0.334	Contact Map
1nslA	3	0.9309	100	0.344	Contact Map
3igrA	2	0.9468	100	0.351	Contact Map
3fbuA	2	0.8883	100	0.351	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.