Q9HMZ0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMZ0 - Uncharacterized protein

UniProt:	Q9HMZ0	Sequences: MDWVVVLGGLALSLGGFEAVSRLQDRLGRPSDGLEPHVWKWLVPAAVAGYVLAVEGRPLSSIGWTVAGPLPFAYHTAVGLAAMLGSALLFSPLWEALGTADAMRDGMAAFTDRSVAELLVVAGTAGVTEEVPYRGYAVERVTALTGSPLLAAAVSLVAFLAAHVGEHWSRAAAVQMAQPTVVLLALYLWTHSLPVVMAVHALNDAVGLLLADRAGEPDSA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	220 (195)
Sequences:	4343 (3849)
Seq/√Len:	275.6

BACSU - YDIL YYAK YPBD
HALSA - Q9HMZ0 Q9HS87 Q9HNQ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
152_A	184_L	4.250	1.00
160_L	177_A	3.859	1.00
138_V	188_L	3.709	1.00
122_A	205_A	3.538	1.00
126_G	201_A	3.334	1.00
138_V	184_L	2.831	1.00
157_V	177_A	2.725	1.00
203_N	207_G	2.696	1.00
142_T	188_L	2.666	1.00
160_L	176_M	2.655	1.00
133_Y	162_A	2.605	1.00
192_S	195_V	2.601	1.00
185_A	189_W	2.579	1.00
156_L	181_V	2.554	1.00
148_P	188_L	2.410	1.00
169_S	172_A	2.364	1.00
187_Y	196_V	2.323	1.00
152_A	188_L	2.320	1.00
172_A	176_M	2.300	1.00
156_L	184_L	2.226	1.00
138_V	155_S	2.156	1.00
186_L	199_V	2.132	1.00
50_Y	54_V	2.083	1.00
152_A	181_V	2.076	1.00
160_L	180_T	2.047	1.00
125_A	201_A	2.043	1.00
127_V	197_M	1.854	1.00
148_P	152_A	1.833	1.00
138_V	151_A	1.767	1.00
9_G	13_S	1.740	1.00
126_G	204_D	1.720	1.00
201_A	205_A	1.630	1.00
156_L	177_A	1.612	1.00
180_T	184_L	1.593	1.00
49_G	53_A	1.582	1.00
73_A	77_A	1.580	1.00
74_Y	78_V	1.577	1.00
194_P	197_M	1.555	1.00
139_E	142_T	1.535	1.00
18_E	21_S	1.503	1.00
123_G	201_A	1.485	1.00
155_S	180_T	1.474	1.00
155_S	184_L	1.453	1.00
187_Y	190_T	1.401	1.00
149_L	153_A	1.400	1.00
135_G	193_L	1.358	1.00
122_A	125_A	1.352	1.00
153_A	181_V	1.341	1.00
103_M	107_M	1.330	1.00
125_A	197_M	1.329	1.00
137_A	158_A	1.305	1.00
142_T	191_H	1.302	1.00
179_P	183_L	1.300	1.00
156_L	160_L	1.298	1.00
134_R	159_F	1.290	1.00
184_L	188_L	1.290	1.00
186_L	195_V	1.277	1.00
135_G	139_E	1.259	1.00
48_A	52_L	1.226	1.00
138_V	187_Y	1.219	1.00
183_L	196_V	1.214	1.00
152_A	185_A	1.211	1.00
127_V	201_A	1.195	1.00
95_E	98_G	1.187	1.00
138_V	142_T	1.184	1.00
173_A	176_M	1.183	1.00
138_V	152_A	1.181	1.00
72_F	75_H	1.174	1.00
155_S	187_Y	1.160	1.00
12_L	16_G	1.157	1.00
169_S	176_M	1.157	1.00
13_S	17_F	1.136	1.00
77_A	81_A	1.128	1.00
150_L	154_V	1.118	1.00
177_A	181_V	1.117	1.00
71_P	75_H	1.103	1.00
192_S	196_V	1.103	1.00
122_A	208_L	1.102	1.00
136_Y	140_R	1.094	1.00
122_A	126_G	1.085	1.00
149_L	152_A	1.083	1.00
156_L	180_T	1.057	1.00
51_V	55_E	1.052	1.00
149_L	185_A	1.048	1.00
14_L	18_E	1.044	1.00
145_T	151_A	1.040	1.00
11_A	14_L	1.031	1.00
10_L	14_L	1.023	1.00
104_R	108_A	1.018	1.00
160_L	173_A	1.015	1.00
172_A	175_Q	1.015	1.00
123_G	126_G	1.009	1.00
36_P	40_K	1.007	1.00
186_L	196_V	1.004	1.00
137_A	155_S	1.000	1.00
10_L	13_S	0.995	1.00
187_Y	192_S	0.993	1.00
141_V	154_V	0.990	1.00
195_V	198_A	0.980	1.00
79_G	202_L	0.972	1.00
114_S	209_L	0.966	1.00
22_R	25_D	0.962	1.00
13_S	18_E	0.958	1.00
146_G	150_L	0.955	1.00
142_T	148_P	0.955	1.00
183_L	199_V	0.949	1.00
12_L	15_G	0.948	1.00
17_F	21_S	0.944	1.00
203_N	206_V	0.943	1.00
197_M	201_A	0.934	1.00
121_V	125_A	0.930	1.00
32_D	36_P	0.928	1.00
40_K	43_V	0.916	1.00
9_G	12_L	0.911	1.00
11_A	15_G	0.905	1.00
15_G	19_A	0.903	1.00
41_W	45_A	0.899	1.00
193_L	197_M	0.898	1.00
139_E	191_H	0.898	1.00
196_V	204_D	0.895	1.00
142_T	151_A	0.888	1.00
141_V	151_A	0.884	1.00
43_V	47_V	0.884	1.00
21_S	24_Q	0.884	1.00
15_G	18_E	0.877	1.00
44_P	47_V	0.869	1.00
43_V	46_A	0.867	1.00
181_V	184_L	0.866	1.00
141_V	145_T	0.859	1.00
60_S	63_G	0.856	1.00
14_L	17_F	0.853	1.00
33_G	36_P	0.848	1.00
139_E	187_Y	0.848	1.00
70_L	74_Y	0.848	1.00
202_L	205_A	0.847	1.00
176_M	179_P	0.840	1.00
181_V	185_A	0.838	1.00
102_A	105_D	0.837	1.00
151_A	155_S	0.832	1.00
133_Y	159_F	0.829	1.00
105_D	109_A	0.820	0.99
198_A	201_A	0.812	0.99
175_Q	178_Q	0.806	0.99
10_L	15_G	0.801	0.99
173_A	177_A	0.796	0.99
103_M	106_G	0.777	0.99
193_L	196_V	0.776	0.99
105_D	108_A	0.775	0.99
101_D	104_R	0.768	0.99
125_A	128_T	0.767	0.99
94_W	98_G	0.765	0.99
124_T	128_T	0.764	0.99
91_S	98_G	0.757	0.99
135_G	203_N	0.755	0.99
145_T	150_L	0.752	0.99
91_S	95_E	0.749	0.99
198_A	202_L	0.748	0.99
41_W	44_P	0.745	0.99
122_A	201_A	0.742	0.99
175_Q	203_N	0.733	0.99
162_A	169_S	0.732	0.99
126_G	197_M	0.732	0.99
93_L	96_A	0.726	0.99
18_E	22_R	0.723	0.99
170_R	173_A	0.712	0.98
79_G	83_M	0.711	0.98
72_F	76_T	0.693	0.98
86_S	89_L	0.692	0.98
70_L	73_A	0.691	0.98
122_A	204_D	0.690	0.98
150_L	153_A	0.688	0.98
151_A	176_M	0.681	0.98
14_L	25_D	0.678	0.98
88_L	92_P	0.676	0.98
159_F	163_H	0.675	0.98
94_W	99_T	0.675	0.98
39_W	44_P	0.673	0.98
106_G	109_A	0.671	0.98
17_F	25_D	0.670	0.98
205_A	209_L	0.669	0.98
32_D	38_V	0.669	0.98
160_L	172_A	0.667	0.98
187_Y	191_H	0.659	0.98
118_L	122_A	0.659	0.98
75_H	79_G	0.659	0.98
21_S	25_D	0.654	0.97
141_V	192_S	0.654	0.97
123_G	127_V	0.654	0.97
176_M	180_T	0.652	0.97
126_G	176_M	0.647	0.97
42_L	46_A	0.647	0.97
164_V	169_S	0.647	0.97
9_G	18_E	0.645	0.97
52_L	55_E	0.644	0.97
169_S	173_A	0.644	0.97
40_K	45_A	0.642	0.97
191_H	196_V	0.642	0.97
37_H	40_K	0.639	0.97
131_V	197_M	0.634	0.97
92_P	95_E	0.630	0.97
118_L	208_L	0.627	0.97
159_F	204_D	0.625	0.97
169_S	175_Q	0.623	0.97
117_E	121_V	0.622	0.96
35_E	53_A	0.619	0.96
161_A	173_A	0.618	0.96
16_G	20_V	0.617	0.96
37_H	42_L	0.617	0.96
10_L	16_G	0.613	0.96
87_A	91_S	0.613	0.96
45_A	48_A	0.612	0.96
135_G	192_S	0.610	0.96
20_V	25_D	0.604	0.96
148_P	151_A	0.603	0.96
146_G	151_A	0.601	0.96
114_S	117_E	0.601	0.96
155_S	173_A	0.601	0.96
12_L	18_E	0.601	0.96
190_T	195_V	0.599	0.96
50_Y	53_A	0.599	0.96
172_A	179_P	0.598	0.96
103_M	108_A	0.596	0.96
133_Y	155_S	0.596	0.96
78_V	82_A	0.592	0.95
146_G	154_V	0.591	0.95
39_W	42_L	0.587	0.95
90_F	94_W	0.587	0.95
36_P	43_V	0.585	0.95
9_G	21_S	0.584	0.95
119_L	123_G	0.583	0.95
19_A	23_L	0.582	0.95
60_S	65_T	0.582	0.95
121_V	208_L	0.581	0.95
39_W	43_V	0.580	0.95
92_P	116_A	0.580	0.95
16_G	26_R	0.577	0.95
121_V	126_G	0.577	0.95
40_K	44_P	0.576	0.95
100_A	104_R	0.574	0.95
126_G	172_A	0.573	0.94
15_G	22_R	0.573	0.94
59_L	64_W	0.572	0.94
164_V	173_A	0.572	0.94
171_A	175_Q	0.571	0.94
76_T	80_L	0.568	0.94
47_V	54_V	0.567	0.94
90_F	98_G	0.566	0.94
44_P	48_A	0.560	0.94
89_L	93_L	0.558	0.94
87_A	94_W	0.558	0.94
11_A	18_E	0.557	0.94
134_R	204_D	0.557	0.94
9_G	15_G	0.557	0.94
51_V	54_V	0.555	0.94
131_V	136_Y	0.554	0.93
70_L	76_T	0.552	0.93
15_G	21_S	0.550	0.93
92_P	96_A	0.549	0.93
12_L	19_A	0.548	0.93
19_A	22_R	0.548	0.93
94_W	100_A	0.545	0.93
133_Y	158_A	0.544	0.93
11_A	17_F	0.543	0.93
126_G	133_Y	0.542	0.93
185_A	195_V	0.541	0.93
81_A	85_G	0.538	0.92
149_L	156_L	0.538	0.92
126_G	187_Y	0.534	0.92
49_G	59_L	0.533	0.92
88_L	91_S	0.526	0.92
52_L	56_G	0.525	0.92
13_S	25_D	0.525	0.92
149_L	181_V	0.525	0.92
179_P	203_N	0.524	0.91
161_A	164_V	0.524	0.91
56_G	111_T	0.522	0.91
38_V	44_P	0.521	0.91
132_P	211_A	0.520	0.91
22_R	26_R	0.517	0.91
57_R	60_S	0.515	0.91
135_G	187_Y	0.515	0.91
18_E	23_L	0.512	0.91
71_P	192_S	0.511	0.90
125_A	187_Y	0.508	0.90
9_G	16_G	0.507	0.90
176_M	203_N	0.507	0.90
79_G	199_V	0.507	0.90
70_L	75_H	0.506	0.90
95_E	99_T	0.505	0.90
160_L	204_D	0.503	0.90
79_G	203_N	0.503	0.90
132_P	176_M	0.500	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cadC	1	0.9318	99.9	0.489	Contact Map
4ev6A	3	0.2727	30.2	0.923	Contact Map
4i0uA	4	0.2636	23.9	0.927	Contact Map
2wswA	3	0.75	8	0.941	Contact Map
4c7rA	3	0.7409	7.2	0.942	Contact Map
4m64A	1	0.6727	5.5	0.945	Contact Map
3aqpA	1	0.2273	2.8	0.952	Contact Map
2nq2A	2	0.6182	2.8	0.953	Contact Map
4rp9A	2	0.9364	2.3	0.955	Contact Map
3h90A	3	0.8591	2	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.