Q9HMV3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMV3 - DNA repair protein

UniProt:	Q9HMV3	Sequences: MRIGVVSDIHSNLVALEAVLADMPAVDQLVCAGDVVGYNPWPAACVDTLRERGVPTVMGNHDRMVATGQNFQGNGMAQAGIEHAVEELHDVQRTWIENRPAEQRLADGRVRVIHDHPEFRDKYTYPDEFEPSLLGRGTDDDTPIEDVLILGHTHVQHHETYAAGIVMNPGSVGQPRDEDPRAAYAVVDVDDLSVTEHRVEYDIDAVQAAVSDAGLPARTADRLASGR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	227 (216)
Sequences:	1788 (1390)
Seq/√Len:	94.6

ECOLI - YFCE
BACSU - YSNB
HALSA - Q9HMV3 Q9HMP6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_D	184_Y	3.858	1.00
41_W	44_A	3.817	1.00
43_A	92_Q	3.402	1.00
24_P	52_R	3.115	1.00
17_E	48_T	3.098	1.00
47_D	92_Q	2.814	1.00
26_V	186_V	2.749	1.00
4_G	23_M	2.707	1.00
89_H	92_Q	2.680	1.00
40_P	206_V	2.605	1.00
20_L	48_T	2.463	1.00
208_A	212_D	2.448	1.00
177_D	198_R	2.382	1.00
118_E	122_K	2.217	1.00
111_R	145_E	2.186	1.00
14_V	209_A	2.181	1.00
31_C	56_T	2.150	1.00
41_W	209_A	2.140	1.00
43_A	89_H	2.068	1.00
48_T	52_R	2.052	1.00
6_V	23_M	2.013	1.00
169_P	185_A	2.007	1.00
22_D	197_H	1.996	1.00
4_G	26_V	1.953	1.00
35_V	45_C	1.892	1.00
30_V	112_V	1.837	1.00
109_R	146_D	1.801	1.00
13_L	44_A	1.792	1.00
31_C	35_V	1.789	1.00
5_V	149_I	1.772	1.00
104_R	145_E	1.753	1.00
58_M	63_R	1.735	1.00
112_V	149_I	1.733	1.00
32_A	149_I	1.714	1.00
208_A	211_S	1.713	1.00
63_R	120_R	1.694	1.00
37_G	61_H	1.678	1.00
55_P	103_Q	1.667	1.00
23_M	29_L	1.628	1.00
167_M	185_A	1.621	1.00
204_D	208_A	1.610	1.00
182_A	199_V	1.603	1.00
185_A	194_V	1.591	1.00
14_V	206_V	1.585	1.00
156_Q	183_A	1.582	1.00
43_A	47_D	1.571	1.00
158_H	196_E	1.556	1.00
188_D	195_T	1.548	1.00
110_V	147_V	1.529	1.00
13_L	48_T	1.524	1.00
19_V	182_A	1.481	1.00
153_T	168_N	1.476	1.00
48_T	51_E	1.473	1.00
7_S	151_G	1.470	1.00
150_L	166_V	1.460	1.00
14_V	41_W	1.434	1.00
184_Y	199_V	1.430	1.00
35_V	56_T	1.405	0.99
177_D	183_A	1.398	0.99
62_D	66_A	1.353	0.99
94_T	98_N	1.351	0.99
202_D	205_A	1.344	0.99
185_A	196_E	1.328	0.99
9_I	16_L	1.318	0.99
38_Y	176_R	1.305	0.99
32_A	112_V	1.291	0.99
123_Y	176_R	1.285	0.99
61_H	174_Q	1.283	0.99
158_H	165_I	1.280	0.99
50_R	92_Q	1.275	0.99
43_A	87_E	1.271	0.99
60_N	152_H	1.262	0.99
210_V	220_A	1.260	0.99
12_N	15_A	1.245	0.99
50_R	95_W	1.234	0.99
17_E	21_A	1.232	0.99
2_R	188_D	1.231	0.98
46_V	92_Q	1.230	0.98
13_L	17_E	1.226	0.98
183_A	198_R	1.224	0.98
8_D	154_H	1.223	0.98
50_R	91_V	1.219	0.98
23_M	26_V	1.206	0.98
19_V	199_V	1.201	0.98
181_R	200_E	1.188	0.98
203_I	207_Q	1.186	0.98
6_V	9_I	1.184	0.98
11_S	42_P	1.177	0.98
83_H	87_E	1.157	0.98
11_S	40_P	1.136	0.97
62_D	96_I	1.125	0.97
6_V	31_C	1.124	0.97
4_G	22_D	1.118	0.97
102_E	111_R	1.109	0.97
90_D	94_T	1.105	0.97
149_I	167_M	1.089	0.97
10_H	154_H	1.087	0.97
19_V	172_V	1.084	0.97
18_A	199_V	1.081	0.97
108_G	146_D	1.079	0.97
167_M	194_V	1.063	0.96
13_L	41_W	1.059	0.96
116_H	119_F	1.057	0.96
80_G	84_A	1.057	0.96
85_V	93_R	1.057	0.96
149_I	169_P	1.056	0.96
61_H	176_R	1.054	0.96
149_I	187_V	1.041	0.96
61_H	123_Y	1.037	0.96
116_H	122_K	1.032	0.96
38_Y	174_Q	1.021	0.95
42_P	83_H	1.003	0.95
36_V	46_V	0.980	0.94
57_V	103_Q	0.976	0.94
15_A	201_Y	0.972	0.94
105_L	112_V	0.962	0.93
56_T	99_R	0.960	0.93
6_V	16_L	0.960	0.93
207_Q	220_A	0.954	0.93
47_D	89_H	0.951	0.93
96_I	99_R	0.936	0.93
104_R	111_R	0.933	0.92
37_G	123_Y	0.927	0.92
46_V	95_W	0.920	0.92
132_S	137_G	0.914	0.92
49_L	54_V	0.906	0.91
161_Y	164_G	0.895	0.91
65_V	81_I	0.886	0.90
184_Y	197_H	0.885	0.90
14_V	17_E	0.884	0.90
2_R	27_D	0.883	0.90
62_D	198_R	0.883	0.90
35_V	99_R	0.878	0.90
62_D	65_V	0.875	0.90
174_Q	222_R	0.875	0.90
3_I	28_Q	0.874	0.90
160_T	165_I	0.874	0.90
77_A	80_G	0.870	0.90
56_T	95_W	0.870	0.90
150_L	153_T	0.870	0.90
68_G	85_V	0.869	0.89
7_S	32_A	0.866	0.89
70_N	97_E	0.866	0.89
8_D	60_N	0.862	0.89
41_W	206_V	0.859	0.89
101_A	115_D	0.857	0.89
46_V	50_R	0.851	0.88
28_Q	55_P	0.842	0.88
63_R	67_T	0.837	0.88
6_V	19_V	0.836	0.88
14_V	205_A	0.835	0.88
188_D	191_D	0.831	0.87
66_A	97_E	0.831	0.87
81_I	85_V	0.830	0.87
22_D	199_V	0.827	0.87
113_I	148_L	0.825	0.87
205_A	209_A	0.810	0.86
7_S	171_S	0.803	0.85
19_V	22_D	0.802	0.85
58_M	101_A	0.801	0.85
23_M	184_Y	0.795	0.85
6_V	29_L	0.793	0.85
115_D	153_T	0.777	0.83
49_L	56_T	0.777	0.83
95_W	99_R	0.776	0.83
12_N	201_Y	0.770	0.83
15_A	172_V	0.769	0.83
211_S	220_A	0.766	0.83
37_G	81_I	0.765	0.83
29_L	54_V	0.763	0.82
153_T	157_H	0.763	0.82
189_V	192_L	0.762	0.82
151_G	156_Q	0.762	0.82
179_D	198_R	0.760	0.82
119_F	122_K	0.759	0.82
16_L	49_L	0.758	0.82
188_D	193_S	0.755	0.82
14_V	40_P	0.750	0.81
42_P	84_A	0.750	0.81
21_A	25_A	0.740	0.80
43_A	46_V	0.739	0.80
211_S	217_A	0.739	0.80
28_Q	54_V	0.738	0.80
80_G	215_L	0.735	0.80
9_I	31_C	0.734	0.80
217_A	221_D	0.726	0.79
61_H	152_H	0.724	0.79
159_E	164_G	0.723	0.79
82_E	86_E	0.721	0.79
206_V	209_A	0.720	0.79
83_H	216_P	0.714	0.78
209_A	213_A	0.710	0.78
210_V	213_A	0.709	0.78
38_Y	123_Y	0.708	0.77
31_C	95_W	0.707	0.77
7_S	115_D	0.698	0.76
123_Y	152_H	0.697	0.76
78_Q	82_E	0.697	0.76
147_V	187_V	0.696	0.76
60_N	168_N	0.695	0.76
58_M	66_A	0.694	0.76
36_V	62_D	0.691	0.76
187_V	194_V	0.690	0.76
4_G	29_L	0.689	0.75
4_G	19_V	0.685	0.75
179_D	183_A	0.681	0.75
25_A	94_T	0.679	0.74
134_L	162_A	0.675	0.74
154_H	171_S	0.675	0.74
207_Q	211_S	0.672	0.74
160_T	163_A	0.671	0.74
28_Q	105_L	0.669	0.73
35_V	58_M	0.669	0.73
180_P	203_I	0.669	0.73
30_V	103_Q	0.667	0.73
10_H	16_L	0.666	0.73
35_V	49_L	0.663	0.73
38_Y	210_V	0.661	0.72
64_M	121_D	0.659	0.72
49_L	53_G	0.655	0.72
58_M	120_R	0.653	0.72
129_F	135_G	0.652	0.71
195_T	204_D	0.650	0.71
36_V	66_A	0.646	0.71
17_E	204_D	0.644	0.70
104_R	109_R	0.641	0.70
5_V	169_P	0.635	0.69
38_Y	61_H	0.634	0.69
183_A	196_E	0.632	0.69
143_P	148_L	0.626	0.68
207_Q	210_V	0.623	0.68
20_L	29_L	0.622	0.68
5_V	167_M	0.619	0.67
5_V	30_V	0.619	0.67
110_V	189_V	0.617	0.67
37_G	176_R	0.614	0.67
110_V	187_V	0.613	0.67
31_C	54_V	0.612	0.67
203_I	223_L	0.610	0.66
132_S	135_G	0.609	0.66
21_A	162_A	0.606	0.66
126_P	155_V	0.601	0.65
64_M	73_G	0.601	0.65
74_N	77_A	0.600	0.65
107_D	146_D	0.600	0.65
10_H	171_S	0.598	0.65
93_R	97_E	0.596	0.65
205_A	208_A	0.594	0.64
5_V	185_A	0.592	0.64
165_I	194_V	0.591	0.64
17_E	205_A	0.587	0.63
2_R	186_V	0.587	0.63
116_H	124_T	0.586	0.63
215_L	220_A	0.584	0.63
20_L	52_R	0.582	0.63
35_V	95_W	0.581	0.63
177_D	215_L	0.579	0.62
103_Q	112_V	0.579	0.62
40_P	220_A	0.576	0.62
186_V	197_H	0.576	0.62
117_P	166_V	0.575	0.62
39_N	83_H	0.574	0.62
110_V	192_L	0.574	0.62
18_A	21_A	0.574	0.62
120_R	125_Y	0.573	0.62
104_R	143_P	0.568	0.61
213_A	217_A	0.566	0.61
36_V	80_G	0.566	0.61
49_L	115_D	0.566	0.61
126_P	130_E	0.565	0.60
38_Y	115_D	0.564	0.60
138_T	142_T	0.560	0.60
176_R	222_R	0.560	0.60
204_D	207_Q	0.556	0.59
5_V	187_V	0.554	0.59
17_E	44_A	0.552	0.59
79_A	82_E	0.551	0.59
37_G	84_A	0.551	0.59
5_V	198_R	0.550	0.58
37_G	174_Q	0.548	0.58
65_V	84_A	0.548	0.58
15_A	182_A	0.546	0.58
125_Y	129_F	0.546	0.58
90_D	160_T	0.545	0.58
18_A	202_D	0.545	0.58
115_D	120_R	0.545	0.58
16_L	45_C	0.542	0.57
94_T	97_E	0.542	0.57
4_G	184_Y	0.541	0.57
133_L	137_G	0.538	0.57
3_I	105_L	0.535	0.56
110_V	149_I	0.535	0.56
182_A	201_Y	0.533	0.56
22_D	25_A	0.533	0.56
36_V	45_C	0.533	0.56
211_S	221_D	0.531	0.56
105_L	110_V	0.530	0.56
47_D	90_D	0.528	0.55
46_V	62_D	0.527	0.55
177_D	181_R	0.527	0.55
191_D	212_D	0.527	0.55
23_M	27_D	0.526	0.55
186_V	191_D	0.524	0.55
115_D	172_V	0.523	0.55
10_H	152_H	0.522	0.55
44_A	48_T	0.522	0.55
41_W	83_H	0.520	0.54
152_H	176_R	0.517	0.54
88_L	92_Q	0.517	0.54
38_Y	175_P	0.516	0.54
30_V	55_P	0.516	0.54
73_G	77_A	0.516	0.54
4_G	197_H	0.514	0.53
133_L	136_R	0.513	0.53
47_D	50_R	0.512	0.53
18_A	182_A	0.511	0.53
40_P	83_H	0.510	0.53
64_M	176_R	0.510	0.53
38_Y	84_A	0.510	0.53
21_A	190_D	0.508	0.53
104_R	107_D	0.505	0.52
157_H	166_V	0.504	0.52
108_G	191_D	0.502	0.52
22_D	26_V	0.500	0.51

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1nnwA	2	0.9868	100	0.338	Contact Map
3rqzA	1	0.9648	100	0.403	Contact Map
3qfmA	2	0.9868	100	0.413	Contact Map
3ib7A	2	0.9648	100	0.548	Contact Map
1g5bA	4	0.8238	100	0.572	Contact Map
4j6oA	1	0.8943	100	0.579	Contact Map
3h63A	1	0.9031	100	0.584	Contact Map
3ck2A	1	0.7445	100	0.598	Contact Map
1su1A	3	0.7533	100	0.603	Contact Map
2qjcA	1	0.8106	100	0.603	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.