Q9HMU7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMU7 - Uncharacterized protein

UniProt:	Q9HMU7	Sequences: MSDTERAWLVFREYTDKGLLSLTYATPDGEHVHRKQRSLNAGDPTAAVDVAADDLDPVEDPADVDRYGTEASRMRDEHDPDDTV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	84 (82)
Sequences:	116 (74)
Seq/√Len:	8.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
74_M	78_H	4.534	0.99
71_A	75_R	3.864	0.97
9_L	22_L	2.841	0.85
5_E	31_H	2.478	0.76
74_M	84_V	2.471	0.76
5_E	52_A	2.156	0.65
6_R	49_D	2.136	0.64
70_E	73_R	1.947	0.56
53_D	62_A	1.705	0.46
7_A	56_D	1.629	0.43
65_D	69_T	1.610	0.43
32_V	37_R	1.564	0.41
16_D	19_L	1.508	0.38
38_S	52_A	1.493	0.38
72_S	78_H	1.483	0.37
71_A	74_M	1.479	0.37
58_V	80_P	1.453	0.36
3_D	84_V	1.393	0.34
43_D	83_T	1.374	0.33
13_E	44_P	1.364	0.33
59_E	79_D	1.358	0.33
39_L	44_P	1.332	0.32
17_K	41_A	1.308	0.31
14_Y	34_R	1.278	0.30
4_T	76_D	1.276	0.30
60_D	64_V	1.275	0.30
15_T	36_Q	1.262	0.29
3_D	40_N	1.243	0.29
60_D	63_D	1.221	0.28
33_H	54_D	1.192	0.27
18_G	41_A	1.147	0.26
13_E	41_A	1.145	0.25
15_T	39_L	1.139	0.25
19_L	77_E	1.131	0.25
27_P	47_A	1.109	0.24
13_E	16_D	1.103	0.24
24_Y	29_G	1.058	0.23
19_L	75_R	1.048	0.23
44_P	56_D	1.042	0.22
31_H	40_N	1.039	0.22
37_R	44_P	1.006	0.21
6_R	76_D	1.002	0.21
9_L	28_D	0.986	0.21
41_A	71_A	0.967	0.20
51_A	65_D	0.959	0.20
13_E	37_R	0.955	0.20
16_D	41_A	0.946	0.20
17_K	42_G	0.938	0.20
18_G	32_V	0.937	0.19
4_T	49_D	0.932	0.19
20_L	55_L	0.931	0.19
32_V	36_Q	0.924	0.19
27_P	54_D	0.917	0.19
68_G	84_V	0.914	0.19
28_D	32_V	0.911	0.19
27_P	49_D	0.898	0.18
13_E	23_T	0.892	0.18
34_R	54_D	0.872	0.18
50_V	63_D	0.866	0.18
58_V	63_D	0.854	0.17
7_A	42_G	0.842	0.17
23_T	30_E	0.833	0.17
23_T	32_V	0.827	0.17
7_A	55_L	0.822	0.17
35_K	42_G	0.804	0.16
45_T	49_D	0.785	0.16
23_T	33_H	0.781	0.16
17_K	44_P	0.778	0.16
33_H	47_A	0.776	0.16
57_P	76_D	0.769	0.15
42_G	56_D	0.761	0.15
43_D	59_E	0.755	0.15
66_R	70_E	0.732	0.15
39_L	56_D	0.724	0.15
36_Q	82_D	0.720	0.14
65_D	77_E	0.707	0.14
62_A	84_V	0.698	0.14
15_T	44_P	0.696	0.14
37_R	43_D	0.693	0.14
13_E	32_V	0.692	0.14
35_K	44_P	0.686	0.14
11_F	58_V	0.672	0.13
13_E	18_G	0.661	0.13
17_K	39_L	0.657	0.13
7_A	39_L	0.650	0.13
62_A	83_T	0.649	0.13
30_E	58_V	0.647	0.13
21_S	56_D	0.642	0.13
67_Y	80_P	0.641	0.13
32_V	41_A	0.636	0.13
21_S	36_Q	0.635	0.13
7_A	48_V	0.621	0.13
10_V	70_E	0.615	0.12
27_P	75_R	0.614	0.12
7_A	21_S	0.612	0.12
41_A	48_V	0.605	0.12
6_R	51_A	0.605	0.12
33_H	84_V	0.602	0.12
51_A	69_T	0.596	0.12
39_L	42_G	0.594	0.12
37_R	42_G	0.592	0.12
63_D	82_D	0.592	0.12
4_T	55_L	0.582	0.12
45_T	81_D	0.575	0.12
6_R	34_R	0.569	0.12
34_R	61_P	0.551	0.11
65_D	76_D	0.549	0.11
14_Y	52_A	0.544	0.11
50_V	71_A	0.544	0.11
61_P	82_D	0.533	0.11
77_E	83_T	0.531	0.11
29_G	68_G	0.528	0.11
24_Y	68_G	0.528	0.11
52_A	83_T	0.527	0.11
18_G	40_N	0.524	0.11
18_G	44_P	0.522	0.11
23_T	38_S	0.522	0.11
20_L	54_D	0.522	0.11
3_D	54_D	0.509	0.11
24_Y	46_A	0.509	0.11
29_G	46_A	0.509	0.11
30_E	57_P	0.503	0.11
21_S	41_A	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1w07A	2	0.5714	7.2	0.938	Contact Map
2olrA	1	1	7.1	0.938	Contact Map
1ytmA	1	0.9286	3.8	0.946	Contact Map
1qusA	1	0.9881	3.8	0.946	Contact Map
2gd9A	2	0.3214	3.5	0.946	Contact Map
3nvqA	2	0.3214	3.4	0.947	Contact Map
2affB	1	0.4048	3.3	0.947	Contact Map
4po6B	1	0.1429	3	0.948	Contact Map
1ik9A	2	0.9048	3	0.948	Contact Map
1tvcA	1	0.3571	2.6	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.