Q9HMS1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMS1 - Uncharacterized protein

UniProt:	Q9HMS1	Sequences: MGYNTRAGTESGAGYGAAGTWPAYWIAVVRVLTGWWFFHAGFTKLLEGGLTFDPSGYLQGMAGTVLAPVGTTLAGYPGIIGPMVVIFETLIGLALIVGLLTRFASFGGVMFMTMFWIGNAEYAHGVVNSDFMGLLLFTTIIVFGAGRYYGLDSIVERTDLVQGAPRLKYLLG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (138)
Sequences:	557 (408)
Seq/√Len:	34.7

HALSA - Q9HMS1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
81_G	85_V	4.148	1.00
73_L	118_G	3.179	1.00
94_A	104_A	3.077	1.00
103_F	107_G	3.017	1.00
34_G	96_I	2.989	1.00
99_L	155_V	2.791	1.00
87_F	111_F	2.752	1.00
27_A	31_V	2.657	1.00
42_F	89_T	2.613	1.00
26_I	139_T	2.258	0.99
38_F	89_T	2.253	0.99
64_T	67_A	2.143	0.99
45_L	86_I	2.049	0.98
105_S	146_G	1.823	0.97
19_G	22_P	1.816	0.97
53_D	81_G	1.795	0.96
95_L	104_A	1.790	0.96
65_V	70_G	1.790	0.96
81_G	84_V	1.750	0.96
94_A	97_V	1.696	0.95
54_P	81_G	1.662	0.94
151_L	155_V	1.639	0.94
76_Y	80_I	1.634	0.94
103_F	106_F	1.619	0.94
24_Y	148_Y	1.615	0.94
108_G	137_F	1.601	0.93
154_I	157_R	1.592	0.93
45_L	85_V	1.536	0.92
99_L	151_L	1.493	0.91
144_G	147_R	1.488	0.90
113_T	131_F	1.469	0.90
153_S	157_R	1.467	0.90
23_A	148_Y	1.454	0.89
33_T	132_M	1.416	0.88
69_V	74_A	1.412	0.88
65_V	74_A	1.377	0.87
36_W	133_G	1.374	0.86
80_I	131_F	1.371	0.86
91_I	111_F	1.358	0.86
70_G	117_I	1.352	0.85
64_T	74_A	1.351	0.85
94_A	103_F	1.319	0.84
24_Y	28_V	1.308	0.84
82_P	86_I	1.295	0.83
33_T	95_L	1.258	0.81
65_V	118_G	1.256	0.81
33_T	131_F	1.238	0.80
105_S	141_I	1.217	0.79
117_I	133_G	1.211	0.78
45_L	89_T	1.194	0.77
94_A	107_G	1.161	0.75
112_M	133_G	1.160	0.75
57_Y	118_G	1.152	0.75
97_V	101_T	1.146	0.74
116_W	125_G	1.143	0.74
48_G	51_T	1.121	0.73
20_T	29_V	1.104	0.72
100_L	155_V	1.093	0.71
69_V	72_T	1.093	0.71
73_L	76_Y	1.083	0.70
55_S	59_Q	1.059	0.68
100_L	130_D	1.050	0.68
69_V	73_L	1.044	0.67
87_F	110_M	1.041	0.67
27_A	116_W	1.039	0.67
100_L	103_F	1.036	0.67
87_F	107_G	1.035	0.67
109_V	138_T	1.032	0.66
33_T	96_I	1.026	0.66
32_L	135_L	1.022	0.66
32_L	127_V	1.002	0.64
82_P	85_V	0.993	0.63
78_G	116_W	0.981	0.62
25_W	154_I	0.962	0.61
39_H	115_F	0.956	0.60
29_V	135_L	0.953	0.60
113_T	132_M	0.950	0.60
84_V	115_F	0.946	0.60
42_F	45_L	0.943	0.59
21_W	24_Y	0.930	0.58
111_F	131_F	0.928	0.58
39_H	43_T	0.922	0.58
82_P	90_L	0.922	0.58
29_V	134_L	0.918	0.57
86_I	89_T	0.918	0.57
148_Y	152_D	0.889	0.55
23_A	115_F	0.885	0.54
110_M	132_M	0.883	0.54
109_V	136_L	0.876	0.54
143_F	156_E	0.875	0.54
100_L	107_G	0.869	0.53
19_G	24_Y	0.868	0.53
33_T	112_M	0.866	0.53
18_A	143_F	0.856	0.52
52_F	55_S	0.853	0.52
94_A	99_L	0.842	0.51
131_F	134_L	0.841	0.51
76_Y	79_I	0.826	0.49
147_R	156_E	0.826	0.49
35_W	39_H	0.813	0.48
68_P	72_T	0.812	0.48
99_L	110_M	0.808	0.48
70_G	118_G	0.803	0.47
68_P	131_F	0.800	0.47
146_G	150_G	0.800	0.47
57_Y	73_L	0.799	0.47
70_G	73_L	0.798	0.47
73_L	142_V	0.796	0.47
26_I	143_F	0.785	0.46
62_A	70_G	0.776	0.45
126_V	131_F	0.768	0.44
67_A	70_G	0.767	0.44
34_G	131_F	0.765	0.44
84_V	88_E	0.756	0.43
141_I	145_A	0.751	0.43
113_T	117_I	0.750	0.43
35_W	72_T	0.739	0.42
25_W	139_T	0.731	0.41
125_G	132_M	0.731	0.41
32_L	134_L	0.727	0.41
91_I	115_F	0.724	0.41
75_G	78_G	0.720	0.40
22_P	143_F	0.718	0.40
42_F	46_L	0.711	0.40
27_A	146_G	0.708	0.39
111_F	148_Y	0.705	0.39
87_F	94_A	0.702	0.39
102_R	156_E	0.697	0.39
91_I	118_G	0.696	0.39
60_G	65_V	0.694	0.38
43_T	47_E	0.693	0.38
137_F	140_I	0.692	0.38
36_W	42_F	0.685	0.38
109_V	135_L	0.684	0.38
136_L	140_I	0.682	0.37
158_T	161_V	0.674	0.37
22_P	144_G	0.673	0.37
48_G	52_F	0.671	0.37
127_V	131_F	0.669	0.36
75_G	151_L	0.669	0.36
55_S	60_G	0.668	0.36
53_D	85_V	0.659	0.36
41_G	89_T	0.653	0.35
100_L	152_D	0.640	0.34
130_D	134_L	0.638	0.34
25_W	28_V	0.634	0.34
17_A	132_M	0.633	0.34
48_G	117_I	0.629	0.33
39_H	48_G	0.629	0.33
22_P	26_I	0.626	0.33
61_M	77_P	0.618	0.32
113_T	129_S	0.613	0.32
123_A	129_S	0.612	0.32
100_L	106_F	0.607	0.32
64_T	68_P	0.606	0.32
43_T	46_L	0.606	0.32
88_E	111_F	0.597	0.31
117_I	130_D	0.595	0.31
21_W	136_L	0.595	0.31
109_V	139_T	0.595	0.31
62_A	71_T	0.593	0.31
35_W	127_V	0.589	0.30
87_F	135_L	0.585	0.30
28_V	153_S	0.584	0.30
20_T	144_G	0.582	0.30
61_M	118_G	0.580	0.30
75_G	114_M	0.579	0.30
89_T	93_L	0.574	0.29
105_S	133_G	0.572	0.29
57_Y	61_M	0.566	0.29
143_F	158_T	0.565	0.29
60_G	63_G	0.561	0.28
25_W	29_V	0.560	0.28
85_V	89_T	0.558	0.28
88_E	115_F	0.557	0.28
21_W	138_T	0.557	0.28
47_E	51_T	0.555	0.28
93_L	160_L	0.551	0.28
89_T	158_T	0.551	0.28
101_T	104_A	0.550	0.28
80_I	94_A	0.550	0.28
31_V	36_W	0.548	0.27
54_P	75_G	0.544	0.27
71_T	77_P	0.543	0.27
147_R	152_D	0.543	0.27
18_A	38_F	0.538	0.27
41_G	90_L	0.536	0.27
75_G	116_W	0.535	0.27
20_T	75_G	0.531	0.26
47_E	110_M	0.529	0.26
94_A	100_L	0.528	0.26
54_P	58_L	0.528	0.26
106_F	138_T	0.525	0.26
42_F	128_N	0.525	0.26
71_T	123_A	0.522	0.26
27_A	154_I	0.522	0.26
132_M	160_L	0.521	0.26
29_V	35_W	0.519	0.25
57_Y	91_I	0.516	0.25
32_L	36_W	0.515	0.25
31_V	87_F	0.515	0.25
96_I	160_L	0.505	0.25
39_H	78_G	0.505	0.25
67_A	71_T	0.503	0.24
41_G	115_F	0.503	0.24
33_T	133_G	0.502	0.24
29_V	162_Q	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ao6B	1	0	3.1	0.964	Contact Map
3dctB	1	0.0581	2.6	0.965	Contact Map
3wu2D	1	0.7326	1.7	0.968	Contact Map
4wgvA	2	0.314	1.7	0.969	Contact Map
4pj0K	1	0.186	1.1	0.972	Contact Map
3mklA	1	0.1802	1.1	0.972	Contact Map
3aquA	1	0.343	1	0.973	Contact Map
4s06A	1	0.3779	1	0.973	Contact Map
2jy5A	1	0.1163	1	0.973	Contact Map
1onwA	5	0.3314	1	0.973	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.