Y2432 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y2432 - UPF0145 protein VNG_2432C

UniProt:	Q9HMQ5	Sequences: MEFVTTETVPGREITESLGVARGNTVKARNVGRDITQSIRNITGGELKAYSELLTDARDDALDRMAEDARSMGADAVVNVRLESSEIANGGSEVIAYGTAVTLA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	104 (101)
Sequences:	1572 (918)
Seq/√Len:	91.3

ECOLI - YBJQ
HALSA - Y2432
SULSO - Y1976

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_L	102_T	3.846	1.00
75_D	102_T	3.704	1.00
3_F	80_V	3.274	1.00
16_E	102_T	2.783	1.00
5_T	79_N	2.579	1.00
10_P	17_S	2.386	1.00
23_G	65_M	2.261	1.00
82_L	96_A	2.191	1.00
62_L	82_L	1.985	1.00
63_D	66_A	1.951	1.00
67_E	70_R	1.891	1.00
14_I	78_V	1.862	1.00
55_T	59_D	1.842	1.00
40_R	49_A	1.821	1.00
55_T	68_D	1.620	1.00
46_E	64_R	1.583	1.00
3_F	66_A	1.569	1.00
4_V	9_V	1.536	1.00
18_L	75_D	1.522	1.00
31_V	42_I	1.491	1.00
9_V	12_R	1.476	1.00
27_K	60_D	1.466	1.00
28_A	41_N	1.463	1.00
46_E	51_S	1.452	0.99
26_V	92_S	1.423	0.99
15_T	102_T	1.417	0.99
62_L	96_A	1.412	0.99
21_A	72_M	1.400	0.99
63_D	67_E	1.374	0.99
10_P	13_E	1.346	0.99
27_K	53_L	1.334	0.99
74_A	100_A	1.328	0.99
69_A	74_A	1.321	0.99
59_D	63_D	1.310	0.99
67_E	71_S	1.275	0.99
36_T	49_A	1.246	0.98
68_D	71_S	1.237	0.98
34_D	50_Y	1.234	0.98
60_D	63_D	1.172	0.98
33_R	49_A	1.168	0.98
62_L	66_A	1.134	0.97
21_A	65_M	1.127	0.97
7_E	79_N	1.102	0.97
30_N	36_T	1.095	0.96
22_R	68_D	1.064	0.96
29_R	56_D	1.042	0.95
20_V	80_V	1.017	0.95
25_T	60_D	1.017	0.95
30_N	33_R	1.013	0.95
65_M	77_V	0.999	0.94
53_L	56_D	0.996	0.94
19_G	76_A	0.986	0.94
28_A	47_L	0.966	0.93
13_E	102_T	0.955	0.93
6_T	78_V	0.951	0.92
7_E	78_V	0.938	0.92
8_T	13_E	0.924	0.91
33_R	53_L	0.921	0.91
57_A	94_V	0.915	0.91
23_G	61_A	0.913	0.91
54_L	92_S	0.905	0.90
66_A	70_R	0.898	0.90
35_I	39_I	0.891	0.90
66_A	77_V	0.885	0.89
82_L	95_I	0.884	0.89
29_R	53_L	0.883	0.89
61_A	96_A	0.857	0.88
37_Q	54_L	0.856	0.88
24_N	83_E	0.847	0.87
65_M	80_V	0.846	0.87
65_M	96_A	0.845	0.87
4_V	17_S	0.833	0.86
68_D	72_M	0.806	0.85
56_D	60_D	0.804	0.84
93_E	97_Y	0.781	0.83
32_G	36_T	0.780	0.83
57_A	92_S	0.777	0.82
36_T	41_N	0.775	0.82
41_N	47_L	0.774	0.82
31_V	35_I	0.766	0.81
83_E	91_G	0.753	0.80
37_Q	47_L	0.753	0.80
81_R	97_Y	0.752	0.80
84_S	97_Y	0.750	0.80
52_E	56_D	0.744	0.80
40_R	43_T	0.743	0.79
4_V	10_P	0.737	0.79
40_R	53_L	0.721	0.77
26_V	93_E	0.712	0.76
13_E	16_E	0.710	0.76
6_T	10_P	0.708	0.76
30_N	34_D	0.707	0.76
30_N	35_I	0.696	0.75
8_T	78_V	0.695	0.75
41_N	90_G	0.693	0.75
51_S	64_R	0.693	0.75
78_V	101_V	0.692	0.74
23_G	58_R	0.689	0.74
64_R	97_Y	0.687	0.74
85_S	91_G	0.686	0.74
8_T	79_N	0.686	0.74
15_T	75_D	0.676	0.73
28_A	54_L	0.674	0.73
40_R	48_K	0.674	0.73
31_V	43_T	0.663	0.71
41_N	88_A	0.658	0.71
36_T	43_T	0.657	0.71
38_S	41_N	0.645	0.69
14_I	59_D	0.643	0.69
13_E	75_D	0.638	0.68
4_V	8_T	0.630	0.67
14_I	101_V	0.628	0.67
36_T	39_I	0.623	0.67
83_E	95_I	0.621	0.66
62_L	77_V	0.618	0.66
6_T	79_N	0.617	0.66
6_T	17_S	0.614	0.65
40_R	47_L	0.612	0.65
12_R	15_T	0.605	0.64
29_R	52_E	0.604	0.64
55_T	58_R	0.603	0.64
5_T	14_I	0.602	0.64
16_E	63_D	0.602	0.64
28_A	34_D	0.599	0.64
58_R	86_E	0.595	0.63
53_L	60_D	0.588	0.62
19_G	72_M	0.588	0.62
24_N	54_L	0.586	0.62
18_L	72_M	0.583	0.61
12_R	75_D	0.582	0.61
36_T	48_K	0.573	0.60
29_R	33_R	0.566	0.59
24_N	84_S	0.564	0.59
39_I	42_I	0.555	0.58
84_S	95_I	0.554	0.58
7_E	10_P	0.554	0.58
5_T	80_V	0.553	0.57
2_E	25_T	0.538	0.55
33_R	40_R	0.528	0.54
88_A	91_G	0.528	0.54
9_V	73_G	0.522	0.53
50_Y	87_I	0.520	0.53
22_R	95_I	0.520	0.53
47_L	64_R	0.518	0.53
14_I	17_S	0.517	0.52
2_E	8_T	0.516	0.52
81_R	85_S	0.509	0.51
49_A	52_E	0.502	0.50
56_D	101_V	0.502	0.50
4_V	20_V	0.501	0.50
6_T	9_V	0.500	0.50
84_S	94_V	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vr4A	3	0.9904	100	0.046	Contact Map
1y2iA	3	0.9904	100	0.052	Contact Map
3qkbA	3	0.8365	99.9	0.268	Contact Map
2jz7A	3	0.6538	99.8	0.411	Contact Map
2y1bA	1	0.7885	99.1	0.651	Contact Map
3ox4A	2	0.9231	20	0.916	Contact Map
4o5fA	2	0.9712	15.4	0.921	Contact Map
1rrmA	2	0.9231	13.3	0.923	Contact Map
4qgsA	2	0.8846	11.4	0.925	Contact Map
5b8hA	2	0.9712	10.1	0.927	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.