Q9HMP5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMP5 - Uncharacterized protein

UniProt:	Q9HMP5	Sequences: MTGLLPSASEPSASSDGPRVVGVDSDDADQLLSALGSETARDIYAAVHDTPSTPSELAADMETSLQNIQYHLDRLEGAALVQECDTRYSSKGREMSVYGARDTPVVLFAGSEEDGESVRAALSGLFGGIGAVSLATVAVQHVGGGGASGVQIGTGAAAQAAPGAATSWDAVWTLMQVARYGLREAVVAGGGLLVVGLGVGAVIAKARAAW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	210 (195)
Sequences:	157 (142)
Seq/√Len:	10.2

HALSA - Q9HMP5 Q9HRQ6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
187_V	190_G	4.972	1.00
54_P	76_E	3.503	0.97
75_L	122_L	3.438	0.97
87_R	91_K	3.241	0.95
83_E	96_S	3.139	0.95
58_A	62_E	3.130	0.94
89_S	92_G	2.463	0.83
81_V	200_G	2.422	0.82
23_V	104_P	2.243	0.77
23_V	125_L	2.199	0.75
21_V	58_A	2.147	0.74
65_L	91_K	2.121	0.73
64_S	67_N	2.114	0.72
64_S	95_M	1.975	0.67
43_I	46_A	1.968	0.67
78_A	86_T	1.948	0.66
34_A	70_Y	1.947	0.66
138_A	142_V	1.867	0.62
20_V	125_L	1.859	0.62
41_R	64_S	1.855	0.62
21_V	87_R	1.842	0.61
32_L	91_K	1.746	0.57
55_S	62_E	1.736	0.56
184_E	192_L	1.700	0.55
28_A	71_H	1.694	0.55
100_A	106_V	1.690	0.54
186_V	191_G	1.674	0.54
79_A	107_L	1.672	0.54
131_A	135_A	1.672	0.54
10_E	61_M	1.657	0.53
23_V	197_L	1.656	0.53
72_L	81_V	1.656	0.53
48_H	100_A	1.605	0.50
150_V	169_D	1.604	0.50
25_S	115_G	1.601	0.50
18_P	109_A	1.591	0.50
44_Y	65_L	1.584	0.49
46_A	63_T	1.582	0.49
12_S	131_A	1.552	0.48
48_H	69_Q	1.526	0.47
27_D	111_S	1.517	0.46
48_H	102_D	1.504	0.46
18_P	33_S	1.406	0.41
62_E	72_L	1.396	0.41
88_Y	94_E	1.388	0.41
52_S	57_L	1.386	0.40
118_V	195_V	1.350	0.39
53_T	64_S	1.346	0.39
43_I	108_F	1.340	0.38
86_T	92_G	1.327	0.38
85_D	97_V	1.326	0.38
70_Y	121_A	1.318	0.37
19_R	67_N	1.316	0.37
63_T	109_A	1.302	0.37
66_Q	95_M	1.301	0.37
132_V	195_V	1.294	0.36
35_L	140_Q	1.292	0.36
158_A	164_A	1.284	0.36
54_P	121_A	1.272	0.35
55_S	59_A	1.271	0.35
142_V	175_M	1.262	0.35
67_N	105_V	1.255	0.35
135_A	187_V	1.245	0.34
41_R	66_Q	1.245	0.34
81_V	188_A	1.233	0.34
10_E	20_V	1.228	0.34
70_Y	130_G	1.209	0.33
41_R	95_M	1.197	0.32
126_F	129_I	1.185	0.32
32_L	93_R	1.182	0.32
121_A	203_I	1.181	0.32
25_S	71_H	1.175	0.31
154_T	166_T	1.175	0.31
155_G	178_A	1.165	0.31
28_A	82_Q	1.164	0.31
43_I	57_L	1.159	0.31
67_N	85_D	1.158	0.31
19_R	88_Y	1.155	0.31
36_G	112_E	1.155	0.31
68_I	176_Q	1.154	0.31
25_S	79_A	1.152	0.31
176_Q	182_L	1.149	0.30
34_A	75_L	1.146	0.30
14_S	122_L	1.123	0.29
16_D	104_P	1.104	0.29
61_M	105_V	1.102	0.29
89_S	94_E	1.097	0.28
149_G	160_A	1.094	0.28
69_Q	102_D	1.086	0.28
56_E	186_V	1.085	0.28
158_A	194_V	1.078	0.28
65_L	69_Q	1.076	0.28
100_A	110_G	1.073	0.28
67_N	88_Y	1.057	0.27
31_L	59_A	1.053	0.27
20_V	107_L	1.043	0.26
66_Q	88_Y	1.041	0.26
154_T	157_A	1.035	0.26
62_E	184_E	1.035	0.26
71_H	191_G	1.024	0.26
150_V	162_P	1.015	0.25
72_L	79_A	1.003	0.25
39_T	92_G	0.998	0.25
39_T	184_E	0.997	0.25
65_L	106_V	0.995	0.25
26_D	77_G	0.992	0.25
149_G	163_G	0.988	0.25
29_D	37_S	0.981	0.24
46_A	144_G	0.974	0.24
107_L	188_A	0.973	0.24
178_A	193_L	0.969	0.24
171_V	176_Q	0.966	0.24
152_I	183_R	0.956	0.23
26_D	65_L	0.949	0.23
79_A	123_S	0.947	0.23
32_L	67_N	0.943	0.23
165_A	168_W	0.942	0.23
68_I	192_L	0.933	0.23
25_S	32_L	0.932	0.23
20_V	91_K	0.926	0.22
161_A	185_A	0.918	0.22
151_Q	154_T	0.918	0.22
72_L	127_G	0.915	0.22
120_A	180_Y	0.915	0.22
20_V	54_P	0.914	0.22
11_P	14_S	0.902	0.22
151_Q	168_W	0.897	0.22
75_L	92_G	0.896	0.22
54_P	104_P	0.888	0.21
32_L	87_R	0.884	0.21
34_A	90_S	0.883	0.21
71_H	95_M	0.881	0.21
57_L	130_G	0.872	0.21
74_R	107_L	0.869	0.21
74_R	194_V	0.867	0.21
46_A	60_D	0.863	0.20
24_D	71_H	0.863	0.20
41_R	53_T	0.861	0.20
149_G	153_G	0.861	0.20
22_G	117_S	0.860	0.20
69_Q	72_L	0.857	0.20
39_T	118_V	0.844	0.20
83_E	102_D	0.839	0.20
91_K	106_V	0.831	0.20
51_P	187_V	0.825	0.19
86_T	128_G	0.824	0.19
27_D	35_L	0.819	0.19
34_A	78_A	0.817	0.19
59_A	166_T	0.817	0.19
26_D	85_D	0.816	0.19
157_A	171_V	0.815	0.19
31_L	52_S	0.808	0.19
53_T	103_T	0.805	0.19
77_G	89_S	0.797	0.19
17_G	202_V	0.796	0.19
53_T	87_R	0.794	0.18
67_N	127_G	0.794	0.18
81_V	85_D	0.791	0.18
121_A	133_S	0.790	0.18
67_N	109_A	0.790	0.18
23_V	84_C	0.783	0.18
171_V	180_Y	0.782	0.18
72_L	95_M	0.779	0.18
156_A	162_P	0.776	0.18
16_D	79_A	0.775	0.18
40_A	45_A	0.766	0.18
86_T	89_S	0.763	0.18
160_A	177_V	0.762	0.18
57_L	186_V	0.762	0.18
78_A	92_G	0.762	0.18
124_G	189_G	0.758	0.18
12_S	176_Q	0.753	0.17
157_A	163_G	0.752	0.17
19_R	66_Q	0.747	0.17
153_G	185_A	0.746	0.17
151_Q	179_R	0.745	0.17
44_Y	60_D	0.737	0.17
151_Q	171_V	0.735	0.17
148_S	181_G	0.735	0.17
68_I	93_R	0.730	0.17
16_D	21_V	0.725	0.17
69_Q	91_K	0.724	0.17
158_A	161_A	0.724	0.17
76_E	104_P	0.721	0.17
66_Q	92_G	0.716	0.16
57_L	72_L	0.713	0.16
53_T	95_M	0.712	0.16
119_R	147_A	0.706	0.16
21_V	79_A	0.702	0.16
162_P	170_A	0.702	0.16
108_F	192_L	0.701	0.16
148_S	168_W	0.700	0.16
154_T	168_W	0.697	0.16
35_L	74_R	0.694	0.16
103_T	107_L	0.689	0.16
175_M	179_R	0.688	0.16
17_G	126_F	0.687	0.16
80_L	94_E	0.686	0.16
54_P	95_M	0.682	0.16
148_S	164_A	0.680	0.16
53_T	80_L	0.677	0.15
184_E	187_V	0.674	0.15
54_P	191_G	0.672	0.15
28_A	97_V	0.667	0.15
141_H	154_T	0.663	0.15
116_E	197_L	0.662	0.15
37_S	87_R	0.662	0.15
25_S	93_R	0.661	0.15
55_S	80_L	0.661	0.15
130_G	145_G	0.659	0.15
47_V	72_L	0.655	0.15
41_R	62_E	0.645	0.15
136_T	182_L	0.644	0.15
25_S	129_I	0.641	0.15
82_Q	139_V	0.638	0.15
170_A	175_M	0.637	0.14
29_D	109_A	0.637	0.14
29_D	67_N	0.633	0.14
177_V	183_R	0.631	0.14
19_R	69_Q	0.629	0.14
25_S	31_L	0.627	0.14
47_V	69_Q	0.627	0.14
115_G	133_S	0.624	0.14
54_P	65_L	0.624	0.14
50_T	185_A	0.616	0.14
175_M	185_A	0.615	0.14
53_T	96_S	0.613	0.14
177_V	180_Y	0.610	0.14
116_E	203_I	0.608	0.14
68_I	107_L	0.608	0.14
53_T	119_R	0.608	0.14
43_I	87_R	0.607	0.14
44_Y	117_S	0.603	0.14
40_A	195_V	0.601	0.14
64_S	109_A	0.600	0.14
42_D	113_E	0.598	0.14
11_P	119_R	0.596	0.14
69_Q	109_A	0.592	0.13
115_G	121_A	0.591	0.13
102_D	125_L	0.591	0.13
34_A	188_A	0.590	0.13
174_L	182_L	0.590	0.13
23_V	67_N	0.586	0.13
174_L	183_R	0.586	0.13
26_D	126_F	0.584	0.13
155_G	177_V	0.584	0.13
81_V	193_L	0.582	0.13
179_R	182_L	0.576	0.13
58_A	81_V	0.573	0.13
31_L	125_L	0.571	0.13
55_S	88_Y	0.568	0.13
37_S	71_H	0.568	0.13
142_V	157_A	0.566	0.13
22_G	91_K	0.563	0.13
66_Q	97_V	0.561	0.13
34_A	86_T	0.560	0.13
84_C	99_G	0.555	0.13
156_A	169_D	0.554	0.13
55_S	69_Q	0.552	0.13
131_A	167_S	0.551	0.13
97_V	106_V	0.547	0.13
51_P	62_E	0.547	0.13
47_V	105_V	0.544	0.12
104_P	140_Q	0.537	0.12
99_G	202_V	0.533	0.12
47_V	99_G	0.532	0.12
129_I	196_G	0.532	0.12
51_P	94_E	0.531	0.12
133_S	163_G	0.531	0.12
21_V	96_S	0.529	0.12
37_S	95_M	0.529	0.12
130_G	186_V	0.529	0.12
167_S	180_Y	0.528	0.12
152_I	169_D	0.526	0.12
43_I	144_G	0.526	0.12
67_N	95_M	0.525	0.12
29_D	39_T	0.524	0.12
67_N	99_G	0.523	0.12
20_V	131_A	0.522	0.12
154_T	174_L	0.521	0.12
55_S	97_V	0.520	0.12
68_I	82_Q	0.519	0.12
69_Q	125_L	0.518	0.12
48_H	107_L	0.515	0.12
36_G	79_A	0.513	0.12
153_G	166_T	0.512	0.12
88_Y	203_I	0.509	0.12
138_A	171_V	0.506	0.12
50_T	53_T	0.506	0.12
60_D	171_V	0.504	0.12
21_V	183_R	0.502	0.12
91_K	108_F	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f6vA	2	0.4524	99	0.834	Contact Map
1q1hA	1	0.3952	98.9	0.839	Contact Map
4g6qA	4	0.6952	98.9	0.84	Contact Map
4k2eA	2	0.4524	98.7	0.85	Contact Map
1r1tA	2	0.4619	98.7	0.851	Contact Map
2qlzA	2	0.7762	98.7	0.852	Contact Map
2oqgA	4	0.5238	98.6	0.852	Contact Map
1y0uA	2	0.4	98.6	0.853	Contact Map
1u2wA	2	0.5143	98.6	0.853	Contact Map
2zkzA	2	0.419	98.6	0.853	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.