Q9HMN9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMN9 - UPF0201 protein VNG_2454C

UniProt:	Q9HMN9	Sequences: MTDTTDVTVRVTAPVYPTEPDDRVADAILRLFPDATVTVEDDRAVAETDTTASFREQLFDQRILDTAREQFQASQTDAGFSFDLKKQAAFNGTVNFAVGNPDELGDLHVEVTVAEPAVQQFIDHLAPPTDGGEPLEDP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (125)
Sequences:	160 (123)
Seq/√Len:	11.0

HALSA - Q9HMN9
SULSO - Y1042

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
55_R	125_L	2.600	0.89
11_V	28_I	2.549	0.88
117_A	120_Q	2.401	0.84
36_T	66_T	2.062	0.74
63_I	67_A	2.051	0.73
67_A	96_F	2.037	0.73
129_T	132_G	2.026	0.72
65_D	96_F	2.018	0.72
97_A	106_D	1.975	0.70
24_V	27_A	1.959	0.70
59_F	64_L	1.950	0.69
25_A	91_N	1.941	0.69
82_F	109_V	1.911	0.68
54_F	94_V	1.909	0.68
58_L	64_L	1.901	0.67
102_D	106_D	1.817	0.64
13_A	28_I	1.791	0.62
82_F	96_F	1.768	0.61
16_Y	57_Q	1.765	0.61
48_T	52_A	1.652	0.56
9_V	94_V	1.633	0.55
28_I	58_L	1.602	0.53
58_L	67_A	1.592	0.53
18_T	95_N	1.562	0.52
44_A	109_V	1.560	0.51
9_V	15_V	1.552	0.51
64_L	132_G	1.521	0.50
92_G	125_L	1.519	0.50
38_T	77_D	1.471	0.47
94_V	126_A	1.445	0.46
85_K	109_V	1.437	0.46
68_R	127_P	1.430	0.45
84_L	94_V	1.400	0.44
65_D	129_T	1.399	0.44
63_I	68_R	1.396	0.44
29_L	94_V	1.395	0.44
28_I	111_V	1.378	0.43
32_F	109_V	1.346	0.41
63_I	96_F	1.326	0.40
9_V	76_T	1.314	0.40
51_T	104_L	1.296	0.39
31_L	118_V	1.280	0.38
29_L	34_D	1.258	0.37
22_D	26_D	1.243	0.37
47_E	125_L	1.236	0.36
127_P	132_G	1.228	0.36
24_V	89_A	1.216	0.35
55_R	124_H	1.198	0.35
50_T	84_L	1.195	0.34
15_V	92_G	1.191	0.34
64_L	127_P	1.165	0.33
88_A	105_G	1.161	0.33
72_Q	123_D	1.142	0.32
97_A	102_D	1.136	0.32
64_L	134_P	1.122	0.31
15_V	24_V	1.112	0.31
75_Q	121_F	1.112	0.31
61_Q	94_V	1.101	0.30
76_T	79_G	1.091	0.30
37_V	40_E	1.089	0.30
44_A	93_T	1.088	0.30
13_A	54_F	1.070	0.29
20_P	23_R	1.056	0.29
105_G	111_V	1.048	0.28
31_L	131_G	1.038	0.28
61_Q	64_L	1.029	0.28
65_D	132_G	1.024	0.27
12_T	72_Q	1.002	0.27
49_D	54_F	0.997	0.26
80_F	118_V	0.985	0.26
83_D	108_H	0.985	0.26
100_N	106_D	0.979	0.26
47_E	102_D	0.974	0.26
90_F	94_V	0.963	0.25
41_D	114_A	0.950	0.25
31_L	97_A	0.931	0.24
88_A	102_D	0.930	0.24
92_G	105_G	0.897	0.23
57_Q	60_D	0.891	0.23
32_F	89_A	0.888	0.23
10_R	45_V	0.886	0.22
66_T	95_N	0.882	0.22
70_Q	92_G	0.882	0.22
38_T	74_S	0.877	0.22
66_T	109_V	0.877	0.22
25_A	29_L	0.874	0.22
74_S	96_F	0.869	0.22
44_A	73_A	0.868	0.22
63_I	95_N	0.865	0.22
78_A	114_A	0.864	0.22
40_E	45_V	0.855	0.21
13_A	18_T	0.850	0.21
55_R	59_F	0.847	0.21
82_F	105_G	0.845	0.21
10_R	116_P	0.842	0.21
51_T	103_E	0.840	0.21
46_A	73_A	0.839	0.21
10_R	77_D	0.833	0.21
27_A	32_F	0.829	0.21
24_V	107_L	0.825	0.20
31_L	60_D	0.814	0.20
75_Q	124_H	0.811	0.20
30_R	125_L	0.805	0.20
96_F	127_P	0.804	0.20
9_V	40_E	0.795	0.20
58_L	63_I	0.794	0.20
22_D	69_E	0.791	0.19
59_F	68_R	0.786	0.19
32_F	82_F	0.778	0.19
48_T	61_Q	0.778	0.19
114_A	117_A	0.771	0.19
61_Q	93_T	0.770	0.19
17_P	41_D	0.769	0.19
89_A	107_L	0.767	0.19
102_D	124_H	0.765	0.19
51_T	124_H	0.765	0.19
28_I	33_P	0.744	0.18
34_D	75_Q	0.737	0.18
68_R	129_T	0.734	0.18
73_A	91_N	0.734	0.18
59_F	98_V	0.733	0.18
72_Q	119_Q	0.732	0.18
16_Y	50_T	0.729	0.18
18_T	22_D	0.727	0.18
27_A	89_A	0.726	0.18
65_D	74_S	0.726	0.18
64_L	129_T	0.717	0.17
100_N	121_F	0.712	0.17
47_E	88_A	0.712	0.17
53_S	56_E	0.712	0.17
103_E	124_H	0.703	0.17
120_Q	130_D	0.699	0.17
8_T	114_A	0.697	0.17
32_F	88_A	0.697	0.17
100_N	104_L	0.694	0.17
60_D	72_Q	0.693	0.17
62_R	99_G	0.689	0.17
115_E	121_F	0.687	0.16
51_T	107_L	0.680	0.16
33_P	66_T	0.672	0.16
8_T	54_F	0.664	0.16
38_T	56_E	0.661	0.16
49_D	71_F	0.658	0.16
75_Q	78_A	0.657	0.16
43_R	131_G	0.657	0.16
57_Q	61_Q	0.654	0.16
51_T	79_G	0.652	0.16
52_A	94_V	0.651	0.16
11_V	70_Q	0.648	0.15
88_A	93_T	0.645	0.15
46_A	95_N	0.645	0.15
123_D	133_E	0.637	0.15
63_I	129_T	0.636	0.15
56_E	62_R	0.633	0.15
21_D	109_V	0.627	0.15
46_A	131_G	0.624	0.15
55_R	134_P	0.619	0.15
53_S	75_Q	0.619	0.15
45_V	80_F	0.615	0.15
16_Y	31_L	0.614	0.15
30_R	83_D	0.612	0.15
95_N	106_D	0.612	0.15
48_T	54_F	0.608	0.14
18_T	63_I	0.607	0.14
68_R	123_D	0.602	0.14
49_D	52_A	0.599	0.14
28_I	83_D	0.593	0.14
109_V	119_Q	0.591	0.14
31_L	134_P	0.587	0.14
20_P	25_A	0.584	0.14
30_R	88_A	0.583	0.14
31_L	125_L	0.572	0.14
85_K	102_D	0.568	0.14
67_A	129_T	0.561	0.13
64_L	116_P	0.560	0.13
129_T	134_P	0.556	0.13
67_A	126_A	0.556	0.13
25_A	33_P	0.550	0.13
62_R	120_Q	0.549	0.13
88_A	91_N	0.539	0.13
24_V	54_F	0.539	0.13
94_V	133_E	0.533	0.13
37_V	73_A	0.533	0.13
58_L	134_P	0.510	0.12
82_F	111_V	0.509	0.12
83_D	97_A	0.508	0.12
35_A	115_E	0.505	0.12
55_R	123_D	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c9gA	2	0.9348	100	0.283	Contact Map
3d7aA	2	0.942	100	0.295	Contact Map
2nwuA	2	0.8841	100	0.296	Contact Map
2pzzA	2	0.9203	100	0.302	Contact Map
2ogkA	4	0.8841	100	0.495	Contact Map
2nrqA	1	0.8043	100	0.52	Contact Map
2wnyA	1	0.8623	99.9	0.54	Contact Map
1gkmA	4	0.4855	12.4	0.951	Contact Map
2qveA	3	0.4928	8.5	0.955	Contact Map
4g9iA	1	0.529	6.7	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.