Q9HMN6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMN6 - Uncharacterized protein

UniProt:	Q9HMN6	Sequences: MSVRRVAATAYREAAPALAASVLGGLFAGAVLGGMRAQLEAVDGLLVVVPALLATRGNVYASFGARLATGLHQGIIEPHVAAGDRRLRAAVGAAMGNGLLASGFAAAVAFGVLTALGRPVAGLATLVGVALVAGLLSGVALTGAVVAVVFAGYRRGYNPDTLVGPLVTTTGDLFGLAFLVLAVRLIVGGV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	190 (180)
Sequences:	737 (528)
Seq/√Len:	39.4

HALSA - Q9HMN6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_A	132_V	3.642	1.00
17_A	21_S	3.023	1.00
13_E	161_T	2.821	1.00
160_D	165_P	2.676	1.00
64_G	68_A	2.660	1.00
164_G	175_G	2.658	1.00
74_G	77_E	2.408	1.00
96_G	108_V	2.402	1.00
141_L	171_G	2.359	1.00
88_R	132_V	2.295	1.00
14_A	21_S	2.232	0.99
71_L	153_Y	2.208	0.99
65_A	173_L	2.133	0.99
56_R	60_Y	2.040	0.99
60_Y	149_V	1.894	0.98
157_Y	163_V	1.885	0.98
45_L	141_L	1.851	0.98
93_A	97_N	1.825	0.98
54_A	69_T	1.817	0.98
123_L	127_V	1.809	0.98
63_F	67_L	1.787	0.98
101_A	119_P	1.784	0.97
56_R	164_G	1.744	0.97
52_L	58_N	1.742	0.97
60_Y	167_V	1.707	0.97
23_L	107_A	1.688	0.96
151_A	154_R	1.675	0.96
56_R	61_A	1.643	0.96
56_R	59_V	1.625	0.96
21_S	25_G	1.617	0.95
60_Y	175_G	1.588	0.95
10_A	14_A	1.557	0.94
17_A	25_G	1.526	0.94
74_G	156_G	1.523	0.94
7_A	19_A	1.496	0.93
44_G	47_V	1.476	0.93
104_F	170_T	1.465	0.92
164_G	168_T	1.455	0.92
52_L	95_M	1.447	0.92
105_A	149_V	1.443	0.92
146_V	150_F	1.428	0.91
56_R	175_G	1.405	0.91
59_V	97_N	1.398	0.90
123_L	132_V	1.377	0.90
48_V	130_A	1.374	0.90
54_A	168_T	1.366	0.89
39_L	180_V	1.357	0.89
129_V	154_R	1.357	0.89
135_L	156_G	1.342	0.89
56_R	62_S	1.341	0.89
152_G	157_Y	1.320	0.88
90_A	98_G	1.318	0.88
58_N	171_G	1.313	0.87
51_A	126_L	1.296	0.87
67_L	144_A	1.290	0.87
91_V	126_L	1.271	0.86
60_Y	141_L	1.270	0.86
139_V	185_L	1.268	0.86
23_L	78_P	1.265	0.85
52_L	61_A	1.260	0.85
125_T	154_R	1.245	0.84
62_S	164_G	1.245	0.84
171_G	180_V	1.244	0.84
65_A	160_D	1.227	0.84
154_R	181_L	1.212	0.83
147_A	185_L	1.210	0.83
151_A	155_R	1.200	0.82
37_A	111_G	1.198	0.82
67_L	101_A	1.193	0.82
31_V	101_A	1.185	0.81
24_G	56_R	1.183	0.81
114_T	118_R	1.179	0.81
148_V	170_T	1.145	0.79
174_F	177_A	1.144	0.79
18_L	113_L	1.142	0.79
149_V	158_N	1.141	0.79
144_A	154_R	1.137	0.79
112_V	181_L	1.121	0.78
149_V	177_A	1.118	0.77
99_L	103_G	1.109	0.77
80_V	83_G	1.109	0.77
181_L	185_L	1.102	0.76
106_A	114_T	1.098	0.76
163_V	174_F	1.078	0.75
131_L	151_A	1.071	0.74
110_F	133_A	1.064	0.74
21_S	30_A	1.063	0.74
45_L	183_V	1.062	0.74
60_Y	63_F	1.055	0.73
59_V	164_G	1.053	0.73
23_L	119_P	1.052	0.73
40_E	181_L	1.049	0.73
152_G	163_V	1.045	0.72
146_V	180_V	1.024	0.71
45_L	176_L	1.014	0.70
120_V	124_A	1.006	0.70
8_A	12_R	1.001	0.69
42_V	181_L	0.995	0.69
66_R	72_H	0.987	0.68
13_E	53_L	0.982	0.68
85_R	157_Y	0.980	0.67
43_D	180_V	0.974	0.67
133_A	182_A	0.972	0.67
141_L	149_V	0.970	0.67
168_T	179_L	0.953	0.65
49_V	111_G	0.948	0.65
48_V	53_L	0.939	0.64
107_A	134_G	0.935	0.64
99_L	107_A	0.932	0.64
54_A	137_S	0.931	0.63
166_L	170_T	0.922	0.63
117_G	144_A	0.921	0.63
31_V	107_A	0.919	0.62
59_V	98_G	0.907	0.61
80_V	119_P	0.895	0.60
102_S	106_A	0.893	0.60
119_P	181_L	0.892	0.60
99_L	135_L	0.888	0.60
125_T	184_R	0.886	0.60
28_A	92_G	0.881	0.59
65_A	72_H	0.880	0.59
62_S	72_H	0.878	0.59
168_T	175_G	0.876	0.59
54_A	66_R	0.872	0.58
58_N	64_G	0.870	0.58
99_L	131_L	0.869	0.58
148_V	158_N	0.864	0.58
67_L	182_A	0.864	0.58
26_L	62_S	0.861	0.57
33_G	51_A	0.861	0.57
13_E	128_G	0.856	0.57
66_R	69_T	0.855	0.57
156_G	174_F	0.853	0.57
56_R	137_S	0.852	0.57
70_G	183_V	0.846	0.56
129_V	182_A	0.844	0.56
17_A	22_V	0.841	0.56
45_L	73_Q	0.836	0.55
165_P	169_T	0.836	0.55
48_V	179_L	0.833	0.55
96_G	111_G	0.833	0.55
68_A	157_Y	0.825	0.54
69_T	99_L	0.819	0.54
9_T	41_A	0.818	0.54
85_R	88_R	0.814	0.53
119_P	122_G	0.814	0.53
150_F	154_R	0.808	0.53
11_Y	14_A	0.807	0.53
161_T	167_V	0.805	0.52
103_G	116_L	0.805	0.52
111_G	180_V	0.805	0.52
8_A	30_A	0.793	0.51
13_E	20_A	0.787	0.51
89_A	94_A	0.787	0.51
45_L	74_G	0.787	0.51
53_L	137_S	0.786	0.51
57_G	69_T	0.784	0.50
167_V	171_G	0.781	0.50
100_L	104_F	0.781	0.50
130_A	134_G	0.778	0.50
45_L	116_L	0.777	0.50
69_T	105_A	0.774	0.50
99_L	110_F	0.772	0.49
150_F	169_T	0.766	0.49
132_V	136_L	0.762	0.48
61_A	65_A	0.762	0.48
120_V	166_L	0.758	0.48
129_V	177_A	0.755	0.48
90_A	95_M	0.749	0.47
38_Q	42_V	0.747	0.47
50_P	127_V	0.743	0.47
144_A	166_L	0.741	0.47
96_G	112_V	0.740	0.46
54_A	65_A	0.740	0.46
141_L	170_T	0.737	0.46
13_E	24_G	0.733	0.46
111_G	147_A	0.733	0.46
90_A	97_N	0.733	0.46
23_L	83_G	0.730	0.46
94_A	150_F	0.728	0.45
17_A	54_A	0.728	0.45
24_G	60_Y	0.725	0.45
49_V	53_L	0.715	0.44
25_G	60_Y	0.702	0.43
49_V	143_G	0.698	0.43
64_G	163_V	0.698	0.43
165_P	172_D	0.697	0.43
14_A	22_V	0.697	0.43
95_M	105_A	0.693	0.42
125_T	144_A	0.692	0.42
46_L	130_A	0.686	0.42
19_A	123_L	0.681	0.41
12_R	99_L	0.677	0.41
8_A	108_V	0.675	0.41
11_Y	22_V	0.671	0.40
142_T	153_Y	0.670	0.40
52_L	158_N	0.663	0.40
21_S	28_A	0.662	0.39
105_A	109_A	0.661	0.39
68_A	108_V	0.659	0.39
63_F	173_L	0.653	0.39
57_G	160_D	0.653	0.39
53_L	138_G	0.651	0.39
48_V	109_A	0.649	0.38
55_T	164_G	0.647	0.38
100_L	116_L	0.645	0.38
26_L	88_R	0.640	0.38
45_L	118_R	0.640	0.38
67_L	70_G	0.637	0.37
27_F	136_L	0.627	0.36
37_A	184_R	0.625	0.36
107_A	130_A	0.621	0.36
86_R	89_A	0.619	0.36
98_G	102_S	0.617	0.36
79_H	111_G	0.613	0.35
49_V	73_Q	0.611	0.35
113_L	117_G	0.611	0.35
28_A	50_P	0.606	0.35
77_E	153_Y	0.603	0.34
55_T	97_N	0.601	0.34
17_A	65_A	0.598	0.34
60_Y	145_V	0.592	0.34
21_S	24_G	0.591	0.34
28_A	173_L	0.590	0.33
55_T	129_V	0.590	0.33
166_L	169_T	0.590	0.33
58_N	161_T	0.589	0.33
20_A	71_L	0.585	0.33
54_A	62_S	0.583	0.33
28_A	69_T	0.577	0.32
128_G	156_G	0.572	0.32
50_P	74_G	0.572	0.32
159_P	165_P	0.571	0.32
173_L	183_V	0.571	0.32
124_A	170_T	0.571	0.32
157_Y	170_T	0.568	0.32
8_A	115_A	0.565	0.31
90_A	139_V	0.565	0.31
65_A	145_V	0.564	0.31
108_V	173_L	0.555	0.31
46_L	61_A	0.554	0.31
27_F	144_A	0.552	0.30
51_A	158_N	0.552	0.30
78_P	132_V	0.550	0.30
88_R	119_P	0.548	0.30
75_I	185_L	0.548	0.30
94_A	110_F	0.548	0.30
11_Y	15_A	0.547	0.30
9_T	155_R	0.540	0.30
137_S	178_F	0.538	0.29
18_L	62_S	0.535	0.29
60_Y	72_H	0.527	0.29
114_T	139_V	0.523	0.28
61_A	71_L	0.522	0.28
14_A	46_L	0.521	0.28
93_A	129_V	0.520	0.28
62_S	78_P	0.514	0.28
81_A	85_R	0.512	0.27
18_L	25_G	0.512	0.27
7_A	11_Y	0.511	0.27
79_H	82_A	0.511	0.27
126_L	169_T	0.508	0.27
11_Y	113_L	0.508	0.27
72_H	153_Y	0.504	0.27
45_L	76_I	0.503	0.27
140_A	174_F	0.502	0.27
39_L	46_L	0.501	0.27
62_S	175_G	0.500	0.27
55_T	175_G	0.500	0.27
22_V	62_S	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4u9nA	2	0.9316	99.9	0.447	Contact Map
2zy9A	2	0.9368	99.6	0.636	Contact Map
3j1zP	8	0.8947	5.1	0.95	Contact Map
1f8vD	3	0.1421	4.9	0.95	Contact Map
4ftbD	1	0.1053	4.5	0.951	Contact Map
2mofA	1	0.1789	3.2	0.955	Contact Map
1novD	1	0.1053	3.2	0.955	Contact Map
4lz6A	1	0.9684	2.9	0.956	Contact Map
4mt1A	3	0.3158	2.6	0.957	Contact Map
3ne5A	3	0.4	1.8	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.