PFDA - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PFDA - Prefoldin subunit alpha

UniProt:	Q9HMN2	Sequences: MSLGGGGQQQLQQLSQEIQAIEEEVEELEADVASLRQEQTEIEEAKEALDVLETGATVQVPLGGDAYVRAEVKDMDEVVVSLGGGYAAEQDSDAAASVLDEKKATIDGRIDDVQAEIADLSEEAEQLEQQAQQAQQQMMQQQMQAQQQPQDGEQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (131)
Sequences:	478 (348)
Seq/√Len:	30.4

HALSA - PFDA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_L	131_A	5.577	1.00
91_D	94_A	5.422	1.00
82_L	88_A	4.235	1.00
50_D	96_A	3.040	1.00
90_Q	94_A	2.964	1.00
104_A	108_G	2.929	1.00
104_A	107_D	2.385	0.99
18_I	22_E	2.237	0.99
11_L	49_L	2.224	0.99
68_V	117_I	2.207	0.99
97_S	101_E	2.169	0.98
21_I	127_L	2.093	0.98
77_E	89_E	2.087	0.98
72_V	78_V	2.073	0.98
45_A	99_L	1.991	0.97
50_D	100_D	1.947	0.97
108_G	112_D	1.916	0.96
42_I	98_V	1.847	0.95
130_Q	134_A	1.788	0.95
62_L	134_A	1.783	0.94
32_V	110_I	1.712	0.93
20_A	42_I	1.628	0.91
55_G	71_E	1.598	0.90
19_Q	94_A	1.533	0.89
49_L	92_S	1.519	0.88
44_E	133_Q	1.509	0.88
58_V	69_R	1.508	0.88
100_D	104_A	1.430	0.85
11_L	47_E	1.420	0.84
99_L	102_K	1.406	0.84
54_T	73_K	1.399	0.83
74_D	77_E	1.388	0.83
35_L	85_G	1.382	0.83
46_K	49_L	1.362	0.82
72_V	75_M	1.344	0.81
35_L	42_I	1.308	0.79
38_E	70_A	1.304	0.79
28_L	32_V	1.293	0.78
20_A	84_G	1.268	0.77
27_E	45_A	1.216	0.74
16_Q	19_Q	1.191	0.72
40_T	129_Q	1.187	0.72
18_I	65_D	1.138	0.69
49_L	96_A	1.135	0.68
28_L	117_I	1.134	0.68
86_Y	105_T	1.113	0.67
81_S	84_G	1.094	0.65
60_V	68_V	1.084	0.65
131_A	135_Q	1.078	0.64
66_A	113_V	1.054	0.62
44_E	59_Q	1.045	0.62
45_A	82_L	1.034	0.61
100_D	103_K	1.003	0.59
29_E	55_G	0.984	0.57
65_D	84_G	0.982	0.57
24_E	67_Y	0.971	0.56
23_E	96_A	0.956	0.55
36_R	114_Q	0.943	0.54
41_E	84_G	0.937	0.53
36_R	107_D	0.929	0.53
26_E	30_A	0.927	0.53
89_E	133_Q	0.920	0.52
63_G	134_A	0.909	0.51
17_E	101_E	0.907	0.51
24_E	134_A	0.902	0.51
41_E	118_A	0.899	0.50
46_K	98_V	0.899	0.50
119_D	123_E	0.898	0.50
41_E	65_D	0.897	0.50
54_T	91_D	0.889	0.50
89_E	98_V	0.880	0.49
46_K	99_L	0.879	0.49
63_G	130_Q	0.878	0.49
55_G	136_Q	0.878	0.49
36_R	39_Q	0.871	0.48
22_E	58_V	0.864	0.48
31_D	84_G	0.862	0.47
30_A	62_L	0.862	0.47
13_Q	106_I	0.860	0.47
111_D	135_Q	0.852	0.47
63_G	120_L	0.847	0.46
18_I	70_A	0.846	0.46
119_D	122_E	0.843	0.46
15_S	40_T	0.839	0.46
31_D	120_L	0.837	0.45
18_I	107_D	0.837	0.45
14_L	21_I	0.833	0.45
93_D	115_A	0.830	0.45
28_L	109_R	0.827	0.45
102_K	132_Q	0.822	0.44
66_A	87_A	0.821	0.44
50_D	91_D	0.821	0.44
74_D	113_V	0.813	0.44
51_V	106_I	0.797	0.42
16_Q	69_R	0.797	0.42
57_T	71_E	0.796	0.42
95_A	99_L	0.793	0.42
96_A	104_A	0.775	0.41
118_A	137_Q	0.762	0.40
92_S	106_I	0.761	0.40
82_L	105_T	0.755	0.39
58_V	74_D	0.748	0.39
34_S	72_V	0.747	0.38
38_E	62_L	0.745	0.38
28_L	35_L	0.735	0.38
52_L	125_E	0.731	0.37
72_V	111_D	0.727	0.37
76_D	140_Q	0.720	0.36
32_V	38_E	0.712	0.36
132_Q	136_Q	0.712	0.36
16_Q	44_E	0.708	0.36
104_A	115_A	0.705	0.35
12_Q	139_M	0.703	0.35
59_Q	72_V	0.703	0.35
31_D	66_A	0.697	0.35
37_Q	40_T	0.695	0.35
42_I	84_G	0.691	0.34
54_T	115_A	0.685	0.34
48_A	58_V	0.684	0.34
62_L	74_D	0.683	0.34
77_E	90_Q	0.681	0.34
63_G	66_A	0.678	0.33
11_L	15_S	0.676	0.33
66_A	120_L	0.674	0.33
46_K	80_V	0.673	0.33
79_V	89_E	0.673	0.33
36_R	53_E	0.672	0.33
45_A	101_E	0.671	0.33
72_V	126_Q	0.667	0.33
35_L	106_I	0.664	0.32
12_Q	89_E	0.657	0.32
28_L	138_M	0.656	0.32
16_Q	64_G	0.656	0.32
15_S	25_V	0.652	0.32
23_E	108_G	0.651	0.31
41_E	87_A	0.649	0.31
30_A	50_D	0.648	0.31
31_D	102_K	0.646	0.31
67_Y	132_Q	0.646	0.31
94_A	97_S	0.645	0.31
11_L	130_Q	0.644	0.31
48_A	62_L	0.644	0.31
32_V	117_I	0.643	0.31
45_A	66_A	0.638	0.31
84_G	120_L	0.632	0.30
64_G	81_S	0.629	0.30
50_D	54_T	0.628	0.30
48_A	57_T	0.623	0.30
128_E	135_Q	0.616	0.29
37_Q	60_V	0.610	0.29
62_L	68_V	0.609	0.29
21_I	129_Q	0.605	0.28
11_L	36_R	0.603	0.28
20_A	78_V	0.602	0.28
17_E	41_E	0.602	0.28
24_E	120_L	0.601	0.28
77_E	87_A	0.599	0.28
105_T	139_M	0.597	0.28
99_L	110_I	0.596	0.28
28_L	116_E	0.595	0.28
35_L	81_S	0.593	0.28
53_E	59_Q	0.592	0.28
30_A	97_S	0.591	0.27
47_E	96_A	0.586	0.27
67_Y	86_Y	0.580	0.27
90_Q	139_M	0.579	0.27
17_E	63_G	0.575	0.26
51_V	91_D	0.573	0.26
14_L	102_K	0.572	0.26
108_G	111_D	0.570	0.26
20_A	24_E	0.565	0.26
27_E	46_K	0.565	0.26
10_Q	22_E	0.561	0.26
109_R	124_A	0.560	0.26
18_I	84_G	0.559	0.26
10_Q	87_A	0.558	0.25
57_T	74_D	0.557	0.25
27_E	31_D	0.545	0.25
33_A	72_V	0.544	0.25
82_L	121_S	0.544	0.25
39_Q	44_E	0.543	0.25
91_D	138_M	0.541	0.24
55_G	137_Q	0.537	0.24
11_L	128_E	0.536	0.24
25_V	117_I	0.535	0.24
16_Q	137_Q	0.523	0.23
93_D	137_Q	0.522	0.23
40_T	115_A	0.518	0.23
41_E	120_L	0.517	0.23
46_K	96_A	0.514	0.23
11_L	118_A	0.512	0.23
33_A	117_I	0.512	0.23
108_G	121_S	0.510	0.23
57_T	133_Q	0.508	0.23
14_L	80_V	0.506	0.22
93_D	135_Q	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zdiC	2	0.9286	100	0.393	Contact Map
1fxkC	2	0.8506	99.9	0.416	Contact Map
2zqmA	5	0.7403	98.6	0.761	Contact Map
1fxkA	2	0.6948	98.5	0.772	Contact Map
3aeiA	3	0.6104	96.4	0.846	Contact Map
4q4gX	1	0	51.6	0.916	Contact Map
4cgkA	3	0.9026	47.4	0.918	Contact Map
1i84S	2	0.0649	39.1	0.922	Contact Map
3trtA	2	0.474	38	0.922	Contact Map
3vkgA	2	0.9351	36.6	0.923	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.