Q9HMM7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMM7 - Uncharacterized protein

UniProt:	Q9HMM7	Sequences: MTTPSPLVMRERHTDRGLLVAACDRDVLGETYDNGGTEFTVTESFYDGEAADADAVRAALARATIGNVVGDTAVGIAIDAGHVEAANVLELEGTVHAQFMQF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (94)
Sequences:	156 (121)
Seq/√Len:	12.5

HALSA - Q9HMM7
SULSO - Q97W58

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_V	63_A	3.537	0.99
71_D	95_V	3.238	0.98
22_A	56_V	2.977	0.96
68_V	73_A	2.819	0.94
46_Y	96_H	2.654	0.92
83_V	97_A	2.417	0.88
51_A	56_V	2.386	0.88
76_I	80_A	2.242	0.84
7_L	20_V	2.147	0.81
11_E	30_E	1.992	0.76
22_A	74_V	1.875	0.71
68_V	93_G	1.759	0.66
45_F	98_Q	1.666	0.62
21_A	96_H	1.590	0.58
8_V	21_A	1.535	0.55
31_T	43_E	1.518	0.54
27_V	87_N	1.472	0.52
63_A	66_G	1.386	0.48
31_T	40_T	1.376	0.47
23_C	63_A	1.359	0.46
25_R	74_V	1.353	0.46
7_L	56_V	1.350	0.46
51_A	75_G	1.322	0.44
14_T	17_G	1.305	0.43
31_T	38_E	1.300	0.43
19_L	92_E	1.299	0.43
11_E	79_D	1.280	0.42
55_A	60_L	1.278	0.42
25_R	50_A	1.255	0.41
84_E	87_N	1.234	0.40
10_R	32_Y	1.176	0.37
52_D	56_V	1.160	0.36
24_D	67_N	1.150	0.36
45_F	77_A	1.098	0.33
7_L	76_I	1.096	0.33
11_E	14_T	1.090	0.33
26_D	72_T	1.082	0.33
30_E	92_E	1.039	0.31
18_L	62_R	1.038	0.31
31_T	60_L	1.037	0.31
24_D	96_H	1.036	0.31
32_Y	39_F	1.033	0.31
66_G	84_E	1.031	0.30
23_C	28_L	1.003	0.29
34_N	37_T	1.000	0.29
56_V	62_R	0.997	0.29
20_V	23_C	0.976	0.28
41_V	69_V	0.958	0.27
9_M	21_A	0.947	0.27
12_R	21_A	0.944	0.27
39_F	69_V	0.943	0.27
37_T	42_T	0.939	0.27
68_V	86_A	0.934	0.26
10_R	21_A	0.930	0.26
77_A	98_Q	0.925	0.26
28_L	81_G	0.925	0.26
54_D	81_G	0.920	0.26
39_F	71_D	0.917	0.26
16_R	82_H	0.914	0.26
54_D	58_A	0.910	0.25
71_D	75_G	0.902	0.25
25_R	72_T	0.894	0.25
25_R	86_A	0.890	0.25
43_E	47_D	0.887	0.25
12_R	19_L	0.881	0.24
27_V	95_V	0.877	0.24
32_Y	80_A	0.874	0.24
51_A	58_A	0.871	0.24
32_Y	100_M	0.863	0.24
58_A	74_V	0.857	0.23
86_A	100_M	0.852	0.23
27_V	88_V	0.849	0.23
26_D	85_A	0.831	0.23
14_T	65_I	0.830	0.23
40_T	86_A	0.810	0.22
68_V	77_A	0.803	0.22
57_R	80_A	0.797	0.21
68_V	75_G	0.793	0.21
7_L	53_A	0.784	0.21
41_V	89_L	0.783	0.21
50_A	56_V	0.779	0.21
27_V	65_I	0.773	0.21
67_N	96_H	0.773	0.21
9_M	56_V	0.772	0.20
9_M	51_A	0.763	0.20
51_A	55_A	0.761	0.20
17_G	65_I	0.760	0.20
55_A	58_A	0.759	0.20
28_L	41_V	0.758	0.20
75_G	93_G	0.754	0.20
12_R	100_M	0.750	0.20
28_L	69_V	0.748	0.20
24_D	76_I	0.735	0.19
12_R	65_I	0.733	0.19
21_A	59_A	0.728	0.19
51_A	91_L	0.722	0.19
56_V	73_A	0.716	0.19
53_A	76_I	0.713	0.19
51_A	59_A	0.707	0.18
20_V	56_V	0.700	0.18
21_A	67_N	0.695	0.18
89_L	96_H	0.692	0.18
47_D	74_V	0.686	0.18
27_V	36_G	0.676	0.17
44_S	85_A	0.668	0.17
45_F	63_A	0.662	0.17
7_L	63_A	0.661	0.17
77_A	97_A	0.659	0.17
32_Y	41_V	0.657	0.17
10_R	79_D	0.646	0.17
45_F	96_H	0.646	0.17
45_F	97_A	0.636	0.16
72_T	88_V	0.636	0.16
49_E	88_V	0.631	0.16
47_D	55_A	0.623	0.16
29_G	88_V	0.615	0.16
21_A	45_F	0.613	0.16
10_R	27_V	0.605	0.15
14_T	19_L	0.605	0.15
34_N	90_E	0.596	0.15
11_E	35_G	0.580	0.15
37_T	78_I	0.568	0.15
27_V	86_A	0.566	0.14
9_M	35_G	0.562	0.14
44_S	51_A	0.552	0.14
9_M	22_A	0.550	0.14
41_V	100_M	0.541	0.14
49_E	86_A	0.540	0.14
15_D	52_D	0.539	0.14
83_V	91_L	0.538	0.14
56_V	74_V	0.532	0.14
11_E	20_V	0.525	0.13
26_D	35_G	0.524	0.13
54_D	64_T	0.520	0.13
66_G	99_F	0.515	0.13
55_A	75_G	0.515	0.13
36_G	71_D	0.510	0.13
60_L	89_L	0.506	0.13
66_G	98_Q	0.505	0.13
8_V	85_A	0.500	0.13
13_H	79_D	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qyaA	2	0.9608	100	0.13	Contact Map
2inpL	1	0.549	21.3	0.926	Contact Map
3r07C	1	0.8137	13.9	0.932	Contact Map
4wweA	1	0.4412	13.3	0.932	Contact Map
4wwtA	1	0.4412	12.6	0.933	Contact Map
1rm6B	1	0.6275	11.9	0.934	Contact Map
1rwhA	1	0.7745	11	0.935	Contact Map
3ge3E	1	0.6176	10.7	0.935	Contact Map
3h63A	1	0.6961	8.7	0.937	Contact Map
1t3qC	1	0.6176	7.9	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.