Q9HML2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HML2 - Uncharacterized protein

UniProt:	Q9HML2	Sequences: MVHADLHVHTTNSDGTLTIDAVPDAAHDAGVTAVAITDHDRLHPALDAPVTVRDDITVIHGIELRVDTGPQRVDLLGYGVHGTDALTAECDRIQRDRRDRGRRIIDRVEARLGVSLPLEPRPGLGRPHIARAITAHPDTDYDTMDAVFDSLIGNDGPCFVARDVPDFETGVDLLTDACGLVGLAHPLRYDDPQHALALCAALDAVEAHYPYDRPVGTAPDDGAALVADAIDTHDLIPTGGTDAHDHTLGTAGLDRDAYAAVRTRLAG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	267 (238)
Sequences:	2451 (1829)
Seq/√Len:	118.5

ECOLI - PHPDC
HALSA - Q9HML2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_T	36_I	4.813	1.00
20_D	47_D	4.496	1.00
175_T	203_D	4.180	1.00
181_V	203_D	3.650	1.00
175_T	181_V	3.197	1.00
52_V	58_V	3.077	1.00
17_L	243_A	2.983	1.00
120_P	136_H	2.866	1.00
174_L	179_G	2.807	1.00
89_E	173_L	2.485	1.00
142_D	146_A	2.441	1.00
8_V	22_V	2.411	1.00
213_R	216_G	2.389	1.00
62_I	90_C	2.225	1.00
103_R	106_D	2.174	1.00
8_V	34_V	2.135	1.00
37_T	61_G	2.109	1.00
143_T	146_A	2.045	1.00
114_V	151_L	2.023	1.00
31_V	34_V	1.977	1.00
112_L	158_C	1.942	1.00
182_G	238_T	1.937	1.00
120_P	132_A	1.915	1.00
24_D	51_T	1.887	1.00
227_A	237_P	1.860	1.00
51_T	54_D	1.850	1.00
166_D	169_T	1.814	1.00
62_I	77_G	1.787	1.00
207_A	237_P	1.776	1.00
42_L	87_T	1.751	1.00
91_D	95_R	1.729	1.00
27_H	56_I	1.722	1.00
141_Y	146_A	1.701	1.00
81_H	84_D	1.691	1.00
131_R	144_M	1.673	1.00
182_G	204_A	1.672	1.00
102_R	118_L	1.652	1.00
141_Y	147_V	1.643	1.00
23_P	34_V	1.577	1.00
105_I	118_L	1.563	1.00
17_L	25_A	1.520	1.00
45_A	60_H	1.519	1.00
169_T	172_D	1.515	1.00
85_A	88_A	1.498	1.00
132_A	136_H	1.497	1.00
18_T	21_A	1.480	1.00
145_D	149_D	1.464	1.00
45_A	58_V	1.458	1.00
187_L	216_G	1.433	1.00
78_Y	238_T	1.407	1.00
33_A	57_T	1.375	1.00
174_L	181_V	1.374	1.00
46_L	83_T	1.361	1.00
212_D	226_V	1.361	1.00
109_E	115_S	1.357	1.00
103_R	107_R	1.355	1.00
8_V	26_A	1.346	1.00
42_L	80_V	1.345	1.00
187_L	212_D	1.344	1.00
27_H	55_D	1.340	1.00
228_D	232_T	1.333	1.00
104_I	129_I	1.331	1.00
49_P	60_H	1.324	1.00
26_A	34_V	1.313	1.00
52_V	56_I	1.311	1.00
25_A	28_D	1.310	1.00
208_H	227_A	1.307	1.00
102_R	106_D	1.287	1.00
24_D	28_D	1.286	1.00
77_G	174_L	1.281	1.00
75_L	174_L	1.276	1.00
117_P	120_P	1.257	0.99
21_A	24_D	1.251	0.99
101_G	129_I	1.250	0.99
209_Y	212_D	1.249	0.99
64_L	170_G	1.237	0.99
120_P	135_A	1.235	0.99
76_L	238_T	1.234	0.99
66_V	170_G	1.233	0.99
153_G	156_G	1.232	0.99
209_Y	239_G	1.229	0.99
34_V	58_V	1.226	0.99
180_L	203_D	1.215	0.99
49_P	58_V	1.212	0.99
16_T	245_D	1.203	0.99
207_A	226_V	1.199	0.99
25_A	29_A	1.197	0.99
168_E	172_D	1.195	0.99
172_D	176_D	1.191	0.99
49_P	82_G	1.186	0.99
171_V	200_A	1.181	0.99
101_G	124_L	1.176	0.99
46_L	82_G	1.165	0.99
105_I	129_I	1.162	0.99
105_I	109_E	1.161	0.99
75_L	167_F	1.156	0.99
36_I	44_P	1.148	0.99
208_H	223_A	1.146	0.99
49_P	53_R	1.141	0.99
141_Y	152_I	1.128	0.99
95_R	99_D	1.125	0.99
100_R	148_F	1.124	0.99
97_R	128_H	1.111	0.99
230_I	237_P	1.107	0.99
50_V	53_R	1.097	0.98
40_D	97_R	1.095	0.98
16_T	247_T	1.091	0.98
48_A	58_V	1.090	0.98
4_A	33_A	1.084	0.98
207_A	227_A	1.082	0.98
20_D	24_D	1.072	0.98
89_E	92_R	1.071	0.98
19_I	23_P	1.063	0.98
165_P	170_G	1.060	0.98
187_L	226_V	1.057	0.98
40_D	65_R	1.056	0.98
27_H	54_D	1.053	0.98
168_E	200_A	1.051	0.98
154_N	159_F	1.048	0.98
64_L	90_C	1.045	0.98
100_R	126_R	1.044	0.98
35_A	61_G	1.030	0.98
18_T	22_V	1.025	0.98
126_R	148_F	1.023	0.98
112_L	157_P	1.012	0.97
33_A	59_I	1.003	0.97
52_V	55_D	0.992	0.97
133_I	141_Y	0.988	0.97
89_E	169_T	0.984	0.97
108_V	158_C	0.984	0.97
192_P	195_A	0.981	0.97
11_T	18_T	0.976	0.97
224_A	228_D	0.967	0.97
73_V	189_Y	0.966	0.97
46_L	50_V	0.964	0.97
96_D	163_D	0.962	0.97
105_I	116_L	0.954	0.96
134_T	143_T	0.951	0.96
131_R	135_A	0.951	0.96
205_V	226_V	0.947	0.96
204_A	236_I	0.940	0.96
77_G	80_V	0.931	0.96
48_A	52_V	0.930	0.96
207_A	230_I	0.926	0.96
133_I	138_D	0.921	0.96
49_P	52_V	0.920	0.96
25_A	243_A	0.919	0.96
114_V	133_I	0.915	0.95
59_I	79_G	0.911	0.95
180_L	236_I	0.903	0.95
76_L	204_A	0.903	0.95
107_R	158_C	0.902	0.95
225_L	229_A	0.899	0.95
23_P	48_A	0.899	0.95
17_L	21_A	0.898	0.95
89_E	165_P	0.898	0.95
97_R	100_R	0.893	0.95
98_R	102_R	0.892	0.95
114_V	138_D	0.888	0.95
183_L	202_L	0.887	0.95
214_P	224_A	0.885	0.95
66_V	72_R	0.883	0.94
19_I	51_T	0.883	0.94
116_L	119_E	0.883	0.94
207_A	223_A	0.878	0.94
20_D	51_T	0.877	0.94
24_D	27_H	0.867	0.94
60_H	80_V	0.864	0.94
12_N	47_D	0.852	0.93
66_V	75_L	0.852	0.93
50_V	54_D	0.851	0.93
116_L	132_A	0.846	0.93
127_P	130_A	0.846	0.93
100_R	130_A	0.841	0.93
126_R	152_I	0.830	0.92
45_A	49_P	0.827	0.92
100_R	104_I	0.825	0.92
138_D	141_Y	0.821	0.92
146_A	150_S	0.820	0.92
35_A	45_A	0.820	0.92
99_D	103_R	0.819	0.92
126_R	130_A	0.817	0.92
205_V	229_A	0.817	0.92
23_P	51_T	0.817	0.92
115_S	136_H	0.815	0.92
78_Y	182_G	0.810	0.91
99_D	102_R	0.810	0.91
84_D	177_A	0.810	0.91
225_L	228_D	0.810	0.91
60_H	82_G	0.808	0.91
66_V	167_F	0.807	0.91
188_R	211_Y	0.794	0.91
92_R	96_D	0.792	0.91
101_G	118_L	0.790	0.90
23_P	58_V	0.785	0.90
194_H	198_L	0.783	0.90
197_A	232_T	0.777	0.90
107_R	112_L	0.775	0.90
45_A	82_G	0.768	0.89
134_T	144_M	0.767	0.89
86_L	90_C	0.765	0.89
66_V	93_I	0.764	0.89
62_I	80_V	0.756	0.88
209_Y	223_A	0.751	0.88
100_R	125_G	0.750	0.88
104_I	152_I	0.748	0.88
75_L	181_V	0.747	0.88
31_V	56_I	0.744	0.88
46_L	49_P	0.734	0.87
77_G	170_G	0.730	0.87
39_H	244_H	0.730	0.87
192_P	226_V	0.728	0.86
106_D	111_R	0.727	0.86
79_G	180_L	0.726	0.86
57_T	79_G	0.723	0.86
212_D	223_A	0.722	0.86
171_V	201_A	0.721	0.86
36_I	58_V	0.718	0.86
23_P	52_V	0.713	0.85
199_C	233_H	0.711	0.85
104_I	126_R	0.707	0.85
141_Y	151_L	0.705	0.85
12_N	43_H	0.703	0.84
108_V	114_V	0.701	0.84
175_T	180_L	0.701	0.84
81_H	87_T	0.701	0.84
32_T	57_T	0.700	0.84
131_R	247_T	0.698	0.84
216_G	225_L	0.690	0.83
231_D	237_P	0.689	0.83
134_T	141_Y	0.687	0.83
106_D	109_E	0.686	0.83
173_L	177_A	0.682	0.83
129_I	158_C	0.679	0.82
67_D	164_V	0.677	0.82
185_H	244_H	0.677	0.82
40_D	100_R	0.676	0.82
130_A	147_V	0.675	0.82
23_P	30_G	0.673	0.82
76_L	209_Y	0.671	0.82
86_L	173_L	0.668	0.81
100_R	128_H	0.665	0.81
130_A	152_I	0.664	0.81
193_Q	225_L	0.663	0.81
39_H	242_D	0.662	0.81
117_P	132_A	0.657	0.80
130_A	148_F	0.655	0.80
228_D	231_D	0.652	0.80
43_H	94_Q	0.651	0.80
109_E	117_P	0.647	0.79
23_P	56_I	0.643	0.79
9_H	13_S	0.642	0.79
76_L	182_G	0.641	0.79
124_L	129_I	0.636	0.78
146_A	149_D	0.634	0.78
108_V	129_I	0.630	0.77
174_L	177_A	0.628	0.77
41_R	44_P	0.627	0.77
171_V	175_T	0.625	0.77
213_R	223_A	0.624	0.77
205_V	230_I	0.623	0.77
132_A	138_D	0.620	0.76
75_L	166_D	0.619	0.76
42_L	45_A	0.619	0.76
118_L	124_L	0.619	0.76
12_N	19_I	0.617	0.76
207_A	212_D	0.612	0.75
133_I	152_I	0.609	0.75
7_H	13_S	0.608	0.75
191_D	195_A	0.608	0.75
100_R	152_I	0.607	0.75
192_P	198_L	0.607	0.75
215_V	224_A	0.606	0.75
100_R	127_P	0.606	0.75
172_D	200_A	0.601	0.74
223_A	227_A	0.599	0.74
173_L	176_D	0.597	0.74
97_R	126_R	0.596	0.73
74_D	185_H	0.595	0.73
179_G	182_G	0.591	0.73
83_T	87_T	0.591	0.73
103_R	161_A	0.590	0.73
44_P	51_T	0.589	0.73
75_L	183_L	0.584	0.72
150_S	157_P	0.583	0.72
126_R	147_V	0.581	0.72
167_F	202_L	0.581	0.72
12_N	41_R	0.577	0.71
125_G	148_F	0.574	0.71
92_R	169_T	0.574	0.71
234_D	237_P	0.572	0.70
5_D	8_V	0.571	0.70
36_I	45_A	0.570	0.70
107_R	160_V	0.570	0.70
99_D	224_A	0.569	0.70
95_R	98_R	0.568	0.70
40_D	128_H	0.568	0.70
153_G	160_V	0.567	0.70
202_L	239_G	0.567	0.70
26_A	31_V	0.566	0.70
14_D	185_H	0.563	0.69
98_R	118_L	0.563	0.69
97_R	125_G	0.562	0.69
93_I	162_R	0.561	0.69
60_H	79_G	0.560	0.69
19_I	44_P	0.556	0.68
100_R	147_V	0.554	0.68
44_P	48_A	0.554	0.68
203_D	236_I	0.552	0.68
86_L	186_P	0.549	0.67
33_A	79_G	0.549	0.67
74_D	184_A	0.546	0.67
84_D	176_D	0.545	0.67
9_H	14_D	0.544	0.67
125_G	130_A	0.542	0.66
83_T	175_T	0.541	0.66
165_P	173_L	0.540	0.66
73_V	171_V	0.540	0.66
100_R	160_V	0.538	0.66
127_P	148_F	0.537	0.66
229_A	233_H	0.536	0.65
239_G	245_D	0.535	0.65
172_D	175_T	0.535	0.65
81_H	179_G	0.535	0.65
80_V	86_L	0.535	0.65
126_R	159_F	0.534	0.65
163_D	176_D	0.533	0.65
64_L	174_L	0.533	0.65
245_D	248_L	0.533	0.65
111_R	115_S	0.532	0.65
20_D	54_D	0.532	0.65
65_R	74_D	0.531	0.65
113_G	212_D	0.527	0.64
88_A	91_D	0.526	0.64
211_Y	248_L	0.526	0.64
35_A	78_Y	0.525	0.64
74_D	244_H	0.524	0.64
87_T	91_D	0.524	0.64
174_L	182_G	0.523	0.64
28_D	224_A	0.521	0.63
107_R	161_A	0.521	0.63
92_R	99_D	0.521	0.63
65_R	162_R	0.520	0.63
96_D	162_R	0.520	0.63
205_V	212_D	0.519	0.63
143_T	149_D	0.519	0.63
16_T	246_H	0.515	0.62
95_R	228_D	0.514	0.62
10_T	22_V	0.514	0.62
77_G	181_V	0.514	0.62
76_L	239_G	0.513	0.62
5_D	241_T	0.508	0.61
227_A	230_I	0.508	0.61
40_D	126_R	0.504	0.61
88_A	92_R	0.502	0.60
143_T	152_I	0.502	0.60
112_L	156_G	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yb1A	1	0.9513	100	0.352	Contact Map
3o0fA	1	0.9588	100	0.372	Contact Map
3e38A	4	0.6742	100	0.641	Contact Map
4gc3A	1	0.7416	100	0.663	Contact Map
2anuA	5	0.6367	100	0.663	Contact Map
1m65A	3	0.6891	100	0.666	Contact Map
2yxoA	3	0.7865	99.9	0.683	Contact Map
2wjeA	1	0.7715	99.9	0.685	Contact Map
3qy7A	1	0.7191	99.9	0.691	Contact Map
2w9mA	1	0.7154	99.9	0.716	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0085 seconds.