Q9HML0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HML0 - Zinc-containing ferredoxin

UniProt:	Q9HML0	Sequences: MAIDPQFTENRAQVDTHKGHDVWGPVEEPEKLGVHGTHVAVDFDICLADGACLEDCPVDVFEWVETPDHPESERKADPANETQCIDCMLCVDVCPVDAIDVDAGRA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	106 (90)
Sequences:	549 (418)
Seq/√Len:	44.1

HALSA - Q9HML0
SULSO - Q97VP2 Q97V77 Q97YU8 Q97V60

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_E	65_E	4.228	1.00
15_D	18_K	4.157	1.00
23_W	32_L	3.648	1.00
18_K	34_V	3.432	1.00
42_D	45_I	3.174	1.00
21_D	35_H	2.921	1.00
51_A	54_E	2.657	1.00
100_D	103_A	2.574	1.00
22_V	33_G	2.221	1.00
20_H	32_L	1.884	0.99
45_I	100_D	1.788	0.98
64_V	67_P	1.727	0.98
84_C	87_C	1.661	0.97
88_M	91_V	1.629	0.97
36_G	43_F	1.552	0.96
20_H	23_W	1.517	0.95
60_V	63_W	1.494	0.95
89_L	93_V	1.481	0.95
25_P	28_E	1.444	0.94
39_V	43_F	1.410	0.93
43_F	76_A	1.403	0.93
53_L	77_D	1.375	0.92
70_P	76_A	1.308	0.90
85_I	89_L	1.290	0.89
40_A	81_E	1.289	0.89
91_V	101_V	1.271	0.89
69_H	72_S	1.212	0.86
18_K	36_G	1.181	0.85
43_F	75_K	1.164	0.84
71_E	74_R	1.134	0.82
76_A	95_P	1.133	0.82
60_V	64_V	1.109	0.81
61_F	64_V	1.099	0.80
55_D	59_D	1.096	0.80
55_D	86_D	1.053	0.77
86_D	101_V	1.045	0.77
43_F	103_A	1.036	0.76
88_M	93_V	1.034	0.76
58_V	85_I	1.010	0.74
27_E	34_V	1.001	0.74
60_V	83_Q	0.989	0.73
74_R	80_N	0.985	0.72
21_D	33_G	0.982	0.72
39_V	75_K	0.982	0.72
55_D	92_D	0.982	0.72
21_D	97_D	0.956	0.70
15_D	31_K	0.956	0.70
58_V	93_V	0.953	0.70
89_L	95_P	0.936	0.68
40_A	101_V	0.935	0.68
68_D	78_P	0.924	0.67
42_D	100_D	0.922	0.67
55_D	89_L	0.919	0.67
62_E	67_P	0.915	0.67
16_T	73_E	0.907	0.66
48_A	77_D	0.869	0.63
60_V	65_E	0.863	0.62
19_G	25_P	0.842	0.60
81_E	91_V	0.837	0.60
15_D	36_G	0.837	0.60
74_R	79_A	0.817	0.58
70_P	74_R	0.813	0.58
44_D	61_F	0.791	0.55
58_V	83_Q	0.787	0.55
27_E	48_A	0.786	0.55
33_G	61_F	0.784	0.55
84_C	98_A	0.767	0.53
89_L	92_D	0.744	0.51
98_A	101_V	0.733	0.50
61_F	83_Q	0.731	0.50
17_H	78_P	0.728	0.49
63_W	66_T	0.726	0.49
42_D	82_T	0.724	0.49
80_N	84_C	0.720	0.49
42_D	102_D	0.717	0.48
55_D	93_V	0.713	0.48
56_C	94_C	0.699	0.47
45_I	98_A	0.696	0.46
61_F	67_P	0.695	0.46
86_D	89_L	0.694	0.46
39_V	103_A	0.692	0.46
69_H	74_R	0.667	0.44
48_A	75_K	0.666	0.43
41_V	57_P	0.660	0.43
70_P	73_E	0.659	0.43
26_V	69_H	0.650	0.42
59_D	92_D	0.648	0.42
31_K	44_D	0.645	0.41
51_A	96_V	0.642	0.41
80_N	87_C	0.642	0.41
90_C	94_C	0.634	0.40
56_C	90_C	0.634	0.40
48_A	68_D	0.628	0.40
51_A	95_P	0.626	0.40
17_H	21_D	0.623	0.39
69_H	73_E	0.615	0.39
26_V	37_T	0.614	0.39
54_E	82_T	0.614	0.39
16_T	39_V	0.612	0.38
19_G	28_E	0.597	0.37
45_I	102_D	0.586	0.36
47_L	69_H	0.582	0.36
52_C	56_C	0.574	0.35
52_C	94_C	0.574	0.35
22_V	70_P	0.574	0.35
16_T	59_D	0.573	0.35
14_V	26_V	0.573	0.35
79_A	93_V	0.572	0.35
53_L	63_W	0.569	0.35
54_E	86_D	0.566	0.34
47_L	95_P	0.564	0.34
47_L	50_G	0.562	0.34
51_A	89_L	0.561	0.34
15_D	34_V	0.560	0.34
55_D	58_V	0.558	0.34
24_G	44_D	0.553	0.33
15_D	67_P	0.551	0.33
84_C	90_C	0.547	0.33
25_P	30_E	0.547	0.33
61_F	65_E	0.544	0.32
84_C	88_M	0.536	0.32
89_L	101_V	0.531	0.31
53_L	99_I	0.528	0.31
34_V	99_I	0.527	0.31
31_K	85_I	0.526	0.31
46_C	94_C	0.518	0.30
46_C	56_C	0.518	0.30
27_E	77_D	0.517	0.30
77_D	80_N	0.514	0.30
88_M	101_V	0.511	0.30
52_C	90_C	0.508	0.29
24_G	31_K	0.507	0.29
15_D	103_A	0.502	0.29
89_L	96_V	0.500	0.29
44_D	66_T	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xerA	2	0.9623	99.5	0.528	Contact Map
3gyxB	1	0.5943	99.3	0.575	Contact Map
2c42A	2	1	99.3	0.576	Contact Map
1q16B	2	0.9151	99.3	0.578	Contact Map
3i9v9	1	0.7547	99.3	0.583	Contact Map
1hfeL	2	0.7925	99.3	0.583	Contact Map
1gteA	4	0.9245	99.3	0.586	Contact Map
5c4iB	1	0.8679	99.3	0.587	Contact Map
4uquA	2	1	99.3	0.587	Contact Map
1jnrB	1	0.5943	99.2	0.59	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.