RS6E - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS6E - 30S ribosomal protein S6e

UniProt:	Q9HMJ5	Sequences: MATFQVAVADPESGRTYQFEVDGQDANRFIGREIGAAVDGGAVGLDGYTVEITGGSDDAGRPMREDVDGSDLMEVLLEGGAGFNPDEDGERKRVTVRGKEVSEAVAQLNVAIDEHGEEPVAELLGADGDDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	131 (123)
Sequences:	452 (259)
Seq/√Len:	23.4

HALSA - RS6E
SULSO - RS6E

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_G	50_V	3.738	1.00
64_R	81_A	2.736	0.99
101_V	108_L	2.461	0.98
34_I	52_I	2.409	0.98
55_G	63_M	2.298	0.97
12_E	115_H	2.224	0.97
72_L	94_V	2.207	0.96
63_M	105_V	2.156	0.96
77_L	96_V	2.131	0.96
32_R	38_V	2.123	0.96
79_G	85_P	2.058	0.95
69_G	102_S	1.996	0.94
8_V	19_F	1.945	0.93
20_E	58_D	1.914	0.92
121_A	125_G	1.911	0.92
102_S	105_V	1.827	0.90
120_V	124_L	1.826	0.90
8_V	50_V	1.803	0.90
72_L	80_G	1.767	0.89
29_F	42_A	1.705	0.87
45_L	50_V	1.702	0.87
18_Q	107_Q	1.673	0.86
50_V	110_V	1.665	0.86
67_V	96_V	1.599	0.83
5_Q	9_A	1.557	0.82
97_R	104_A	1.538	0.81
74_E	95_T	1.523	0.80
29_F	46_D	1.518	0.80
53_T	109_N	1.516	0.80
44_G	57_D	1.482	0.78
28_R	39_D	1.478	0.78
73_M	95_T	1.475	0.78
52_I	91_R	1.475	0.78
8_V	110_V	1.450	0.77
29_F	38_V	1.432	0.76
64_R	82_G	1.428	0.75
57_D	72_L	1.427	0.75
51_E	111_A	1.362	0.72
89_G	97_R	1.359	0.72
34_I	41_G	1.351	0.71
26_A	110_V	1.346	0.71
33_E	99_K	1.334	0.70
54_G	57_D	1.281	0.67
21_V	63_M	1.279	0.67
40_G	45_L	1.265	0.66
79_G	95_T	1.256	0.66
87_E	91_R	1.255	0.65
12_E	103_E	1.236	0.64
18_Q	109_N	1.221	0.63
119_P	122_E	1.214	0.63
56_S	83_F	1.211	0.63
47_G	55_G	1.208	0.62
6_V	110_V	1.199	0.62
27_N	43_V	1.164	0.59
79_G	88_D	1.135	0.57
23_G	56_S	1.120	0.56
53_T	92_K	1.118	0.56
66_D	75_V	1.113	0.56
32_R	92_K	1.110	0.56
33_E	100_E	1.101	0.55
115_H	119_P	1.076	0.53
19_F	31_G	1.060	0.52
69_G	106_A	1.050	0.52
63_M	101_V	1.047	0.51
10_D	13_S	1.039	0.51
58_D	72_L	1.031	0.50
16_T	84_N	1.027	0.50
56_S	86_D	1.007	0.49
81_A	92_K	0.993	0.48
26_A	109_N	0.986	0.47
74_E	105_V	0.983	0.47
61_R	95_T	0.973	0.46
52_I	111_A	0.971	0.46
10_D	15_R	0.924	0.43
28_R	42_A	0.908	0.42
22_D	95_T	0.908	0.42
85_P	109_N	0.904	0.41
19_F	44_G	0.894	0.41
38_V	42_A	0.886	0.40
48_Y	116_G	0.875	0.39
54_G	60_G	0.866	0.39
83_F	86_D	0.828	0.36
30_I	86_D	0.825	0.36
59_A	72_L	0.824	0.36
40_G	43_V	0.820	0.36
80_G	101_V	0.816	0.36
45_L	104_A	0.808	0.35
69_G	107_Q	0.804	0.35
35_G	53_T	0.799	0.35
7_A	16_T	0.793	0.34
71_D	109_N	0.785	0.34
33_E	56_S	0.784	0.34
122_E	125_G	0.777	0.33
49_T	114_E	0.776	0.33
76_L	93_R	0.772	0.33
10_D	27_N	0.770	0.33
56_S	85_P	0.769	0.33
62_P	86_D	0.767	0.33
41_G	46_D	0.762	0.32
21_V	110_V	0.732	0.30
84_N	101_V	0.732	0.30
19_F	29_F	0.729	0.30
20_E	68_D	0.728	0.30
34_I	56_S	0.728	0.30
73_M	125_G	0.721	0.30
43_V	112_I	0.718	0.30
42_A	50_V	0.716	0.29
8_V	101_V	0.713	0.29
14_G	92_K	0.711	0.29
93_R	116_G	0.709	0.29
79_G	83_F	0.703	0.29
61_R	74_E	0.700	0.29
50_V	78_E	0.696	0.28
54_G	62_P	0.692	0.28
86_D	111_A	0.682	0.28
9_A	91_R	0.682	0.28
65_E	99_K	0.680	0.27
56_S	107_Q	0.676	0.27
23_G	100_E	0.673	0.27
9_A	40_G	0.672	0.27
37_A	51_E	0.670	0.27
5_Q	94_V	0.669	0.27
32_R	37_A	0.668	0.27
23_G	51_E	0.663	0.26
13_S	71_D	0.657	0.26
117_E	121_A	0.655	0.26
38_V	101_V	0.647	0.26
8_V	45_L	0.643	0.25
64_R	96_V	0.642	0.25
38_V	75_V	0.639	0.25
48_Y	112_I	0.636	0.25
28_R	36_A	0.635	0.25
18_Q	28_R	0.633	0.25
41_G	44_G	0.632	0.25
35_G	109_N	0.627	0.25
79_G	84_N	0.627	0.25
40_G	104_A	0.625	0.24
34_I	109_N	0.620	0.24
10_D	39_D	0.616	0.24
37_A	49_T	0.614	0.24
11_P	99_K	0.614	0.24
61_R	72_L	0.609	0.24
62_P	82_G	0.609	0.24
48_Y	114_E	0.604	0.23
4_F	8_V	0.598	0.23
77_L	82_G	0.592	0.23
12_E	29_F	0.589	0.23
80_G	93_R	0.585	0.22
24_Q	51_E	0.581	0.22
4_F	97_R	0.578	0.22
35_G	51_E	0.572	0.22
48_Y	104_A	0.572	0.22
18_Q	79_G	0.570	0.22
21_V	33_E	0.570	0.22
63_M	98_G	0.569	0.22
27_N	38_V	0.566	0.22
5_Q	106_A	0.566	0.22
6_V	20_E	0.565	0.21
7_A	17_Y	0.562	0.21
9_A	109_N	0.561	0.21
26_A	36_A	0.559	0.21
39_D	42_A	0.558	0.21
85_P	88_D	0.553	0.21
69_G	109_N	0.547	0.21
33_E	36_A	0.547	0.21
9_A	18_Q	0.545	0.21
53_T	107_Q	0.543	0.20
10_D	109_N	0.539	0.20
31_G	39_D	0.538	0.20
74_E	94_V	0.537	0.20
30_I	91_R	0.535	0.20
57_D	89_G	0.528	0.20
81_A	112_I	0.527	0.20
60_G	97_R	0.523	0.20
93_R	98_G	0.521	0.19
82_G	105_V	0.514	0.19
15_R	126_A	0.513	0.19
25_D	33_E	0.512	0.19
28_R	105_V	0.510	0.19
70_S	102_S	0.508	0.19
71_D	102_S	0.505	0.19
6_V	114_E	0.502	0.19
24_Q	94_V	0.502	0.19
36_A	39_D	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4bpeY	1	0.9771	100	0.066	Contact Map
3j7aH	1	0.9771	100	0.067	Contact Map
4ujpH	1	0.9771	100	0.079	Contact Map
4w23G	1	0.9771	100	0.084	Contact Map
3j60G	1	0.9771	100	0.088	Contact Map
3zey3	1	0.9771	100	0.092	Contact Map
3j20G	1	0.8702	100	0.127	Contact Map
4q28A	1	0.3969	21.3	0.946	Contact Map
1grjA	1	0.3893	10.6	0.953	Contact Map
2bwfA	1	0.5496	6.9	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.