Q9HMJ0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMJ0 - Uncharacterized protein

UniProt:	Q9HMJ0	Sequences: MPRGKHTAMIDTVVIATDGSESVGRAVDVALDVAARFDAAVHALYVLEASDVESAPDEVRTDMRDALEERGKDAVSAVADRADVSVTTAVRAGRPPAEISQYARDVDADAVATGTRGRHGENRFLIGSVAERVVRTCPVPVLTVRQLADTDAEQTTA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	157 (137)
Sequences:	21316 (17104)
Seq/√Len:	1461.3

ECOLI - USPE USPF USPG USPC USPA USPD
BACSU - YXIE NHAX
HALSA - Q9HMJ0 Q9HRP5 Q9HNX9 Q9HPF7 Q9HPP5 Q9HRD8 Q9HPQ8 Q9HP90 Q9HMI9 Q9HHX5 Q9HHV8 Q9HHY0 Q9HMU1
SULSO - Q97V57 Q97X90 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_H	89_A	3.001	1.00
12_T	42_H	2.749	1.00
14_V	108_A	2.718	1.00
96_P	132_R	2.554	1.00
40_A	87_T	2.525	1.00
12_T	40_A	2.502	1.00
89_A	102_Y	2.352	1.00
29_V	142_L	2.349	1.00
102_Y	106_V	2.253	1.00
110_A	142_L	2.224	1.00
93_G	98_E	1.943	1.00
113_T	133_V	1.918	1.00
111_V	139_V	1.898	1.00
103_A	111_V	1.849	1.00
42_H	106_V	1.813	1.00
42_H	87_T	1.795	1.00
115_T	145_R	1.753	1.00
91_R	98_E	1.749	1.00
42_H	108_A	1.748	1.00
40_A	85_S	1.744	1.00
131_E	135_R	1.725	1.00
44_L	102_Y	1.673	1.00
42_H	102_Y	1.671	1.00
15_I	30_A	1.658	1.00
16_A	113_T	1.631	1.00
12_T	109_D	1.567	1.00
46_V	98_E	1.539	1.00
16_A	99_I	1.538	1.00
98_E	101_Q	1.518	1.00
79_A	88_T	1.513	1.00
28_D	81_R	1.495	1.00
33_V	37_F	1.475	1.00
71_G	75_V	1.406	1.00
104_R	138_P	1.384	1.00
100_S	136_T	1.360	1.00
68_E	72_K	1.360	1.00
111_V	137_C	1.358	1.00
72_K	76_S	1.337	1.00
89_A	106_V	1.331	1.00
132_R	136_T	1.320	1.00
30_A	34_A	1.312	1.00
39_A	109_D	1.298	1.00
15_I	27_V	1.295	1.00
67_L	70_R	1.280	1.00
103_A	138_P	1.255	1.00
64_R	68_E	1.249	1.00
91_R	102_Y	1.238	1.00
78_V	82_A	1.217	1.00
45_Y	71_G	1.197	1.00
95_P	129_V	1.188	1.00
111_V	133_V	1.187	1.00
74_A	78_V	1.181	1.00
44_L	91_R	1.154	1.00
102_Y	105_D	1.144	1.00
24_G	81_R	1.144	1.00
10_I	140_P	1.129	1.00
70_R	74_A	1.125	1.00
103_A	139_V	1.087	1.00
137_C	141_V	1.084	1.00
29_V	144_V	1.074	1.00
76_S	80_D	1.072	1.00
69_E	73_D	1.054	1.00
46_V	95_P	1.042	1.00
67_L	71_G	1.037	1.00
121_E	125_L	1.035	1.00
27_V	43_A	1.005	1.00
74_A	77_A	0.997	1.00
19_G	45_Y	0.989	1.00
76_S	79_A	0.989	1.00
44_L	99_I	0.987	1.00
71_G	82_A	0.987	1.00
113_T	130_A	0.985	1.00
12_T	108_A	0.971	1.00
115_T	143_T	0.962	1.00
10_I	29_V	0.955	1.00
103_A	108_A	0.949	1.00
101_Q	105_D	0.947	1.00
100_S	103_A	0.934	1.00
134_V	143_T	0.930	1.00
71_G	74_A	0.927	1.00
47_L	92_A	0.925	1.00
78_V	81_R	0.923	1.00
65_D	69_E	0.922	1.00
77_A	81_R	0.919	1.00
13_V	110_A	0.917	1.00
12_T	106_V	0.916	1.00
43_A	86_V	0.906	1.00
123_R	131_E	0.902	1.00
91_R	105_D	0.897	1.00
30_A	112_A	0.896	1.00
23_V	26_A	0.895	1.00
120_G	123_R	0.891	1.00
31_L	84_V	0.891	1.00
34_A	41_V	0.887	1.00
70_R	73_D	0.875	1.00
59_V	62_D	0.863	1.00
130_A	143_T	0.859	1.00
47_L	90_V	0.852	1.00
17_T	43_A	0.849	1.00
29_V	33_V	0.848	1.00
14_V	102_Y	0.838	1.00
25_R	28_D	0.827	1.00
14_V	111_V	0.827	1.00
34_A	37_F	0.826	1.00
37_F	109_D	0.826	1.00
118_R	122_N	0.825	1.00
32_D	36_R	0.818	1.00
115_T	130_A	0.817	1.00
57_D	60_R	0.814	1.00
24_G	77_A	0.813	1.00
30_A	41_V	0.813	1.00
20_S	23_V	0.802	1.00
29_V	32_D	0.799	1.00
77_A	80_D	0.798	1.00
24_G	28_D	0.798	1.00
16_A	114_G	0.798	1.00
14_V	44_L	0.788	1.00
102_Y	108_A	0.786	1.00
94_R	97_A	0.784	1.00
15_I	41_V	0.781	1.00
27_V	78_V	0.778	1.00
17_T	27_V	0.776	1.00
100_S	133_V	0.770	1.00
79_A	82_A	0.766	1.00
10_I	110_A	0.761	1.00
29_V	140_P	0.761	1.00
17_T	26_A	0.754	1.00
100_S	137_C	0.751	1.00
31_L	82_A	0.748	1.00
27_V	31_L	0.744	1.00
35_A	83_D	0.743	1.00
34_A	39_A	0.742	1.00
112_A	142_L	0.740	1.00
13_V	34_A	0.740	1.00
72_K	88_T	0.739	1.00
10_I	109_D	0.737	1.00
61_T	65_D	0.737	1.00
120_G	124_F	0.737	1.00
73_D	77_A	0.735	1.00
17_T	24_G	0.732	1.00
75_V	88_T	0.728	1.00
87_T	106_V	0.724	1.00
62_D	65_D	0.724	1.00
31_L	35_A	0.722	1.00
60_R	64_R	0.715	1.00
76_S	88_T	0.707	1.00
99_I	133_V	0.706	1.00
96_P	129_V	0.704	1.00
66_A	70_R	0.686	1.00
117_G	126_I	0.681	1.00
20_S	117_G	0.679	1.00
17_T	23_V	0.670	1.00
73_D	76_S	0.666	1.00
66_A	69_E	0.666	1.00
32_D	35_A	0.661	1.00
15_I	26_A	0.661	1.00
113_T	143_T	0.661	1.00
71_G	90_V	0.658	1.00
30_A	39_A	0.641	1.00
121_E	124_F	0.640	1.00
11_D	39_A	0.638	1.00
33_V	36_R	0.637	1.00
60_R	63_M	0.636	1.00
11_D	109_D	0.634	1.00
22_S	146_Q	0.633	1.00
112_A	144_V	0.632	1.00
107_D	139_V	0.630	1.00
114_G	144_V	0.627	1.00
12_T	39_A	0.626	1.00
69_E	72_K	0.622	1.00
98_E	102_Y	0.618	1.00
96_P	100_S	0.616	1.00
104_R	139_V	0.597	1.00
62_D	66_A	0.595	1.00
18_D	23_V	0.594	1.00
44_L	98_E	0.594	1.00
68_E	71_G	0.591	1.00
96_P	136_T	0.588	1.00
10_I	39_A	0.576	1.00
133_V	141_V	0.573	1.00
58_E	62_D	0.573	1.00
63_M	66_A	0.573	1.00
83_D	86_V	0.572	1.00
97_A	101_Q	0.571	1.00
126_I	130_A	0.571	1.00
25_R	146_Q	0.571	1.00
96_P	133_V	0.565	1.00
58_E	61_T	0.563	1.00
100_S	132_R	0.561	1.00
99_I	129_V	0.558	1.00
22_S	25_R	0.555	1.00
17_T	78_V	0.552	1.00
33_V	112_A	0.550	1.00
47_L	64_R	0.550	1.00
24_G	74_A	0.546	1.00
26_A	112_A	0.543	1.00
43_A	88_T	0.537	1.00
63_M	67_L	0.532	1.00
134_V	141_V	0.531	1.00
61_T	64_R	0.528	1.00
116_R	130_A	0.517	1.00
82_A	86_V	0.514	1.00
45_Y	74_A	0.510	1.00
43_A	82_A	0.506	1.00
93_G	101_Q	0.500	1.00
91_R	101_Q	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3s3tA	4	0.8854	99.9	0.247	Contact Map
3mt0A	1	0.9236	99.9	0.249	Contact Map
3tnjA	2	0.8089	99.9	0.25	Contact Map
2gm3A	2	0.8408	99.9	0.251	Contact Map
4wnyA	2	0.8025	99.9	0.252	Contact Map
2dumA	2	0.8981	99.9	0.256	Contact Map
2z08A	4	0.7771	99.9	0.261	Contact Map
3hgmA	2	0.8662	99.9	0.262	Contact Map
1mjhA	2	0.8726	99.9	0.264	Contact Map
5ahwA	4	0.8917	99.9	0.265	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.