Q9HMI9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMI9 - Uncharacterized protein

UniProt:	Q9HMI9	Sequences: MPLTVDTVLAPVDGTDASVTAAEYAVTVADRYDADAHALYVLGETVTRAIGTGDVAEDDVAAGTNTFLNEIAALAPDGVAVDSSIAYGFSTSRKRQHPGSVILDAAADIDADFVVIPREGMREETGDVLERAAEYVLLYASQPVLSV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (131)
Sequences:	19517 (15749)
Seq/√Len:	1376.0

ECOLI - USPF USPE USPG USPD USPA USPC
BACSU - NHAX YXIE
HALSA - Q9HMI9 Q9HRD8 Q9HPQ8 Q9HPP5 Q9HRP5 Q9HPF7 Q9HNX9 Q9HMJ0 Q9HHV8 Q9HP90 Q9HHX5 Q9HHY0 Q9HMU1
SULSO - Q97X90 Q97V57 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_H	92_S	3.069	1.00
7_T	37_H	2.897	1.00
9_L	111_A	2.887	1.00
99_G	135_Y	2.795	1.00
24_Y	145_L	2.583	1.00
7_T	35_D	2.445	1.00
113_F	145_L	2.393	1.00
35_D	90_S	2.337	1.00
92_S	105_A	2.199	1.00
114_V	142_Q	2.049	1.00
116_I	136_V	2.043	1.00
37_H	111_A	1.965	1.00
37_H	105_A	1.941	1.00
134_E	138_L	1.925	1.00
96_Q	101_V	1.844	1.00
39_L	105_A	1.824	1.00
106_A	114_V	1.806	1.00
94_K	101_V	1.789	1.00
10_A	25_A	1.780	1.00
11_P	116_I	1.756	1.00
37_H	90_S	1.713	1.00
41_V	101_V	1.711	1.00
11_P	102_I	1.649	1.00
72_A	76_P	1.627	1.00
7_T	112_D	1.615	1.00
28_V	32_Y	1.606	1.00
101_V	104_D	1.595	1.00
72_A	91_T	1.471	1.00
64_T	68_L	1.457	1.00
34_A	112_D	1.438	1.00
103_L	139_Y	1.430	1.00
68_L	72_A	1.421	1.00
135_Y	139_Y	1.414	1.00
107_A	141_S	1.394	1.00
114_V	140_A	1.387	1.00
19_V	74_L	1.364	1.00
106_A	141_S	1.341	1.00
61_A	65_N	1.334	1.00
10_A	22_A	1.328	1.00
25_A	29_A	1.327	1.00
94_K	105_A	1.306	1.00
65_N	69_N	1.288	1.00
114_V	136_V	1.275	1.00
67_F	71_I	1.243	1.00
98_P	132_A	1.204	1.00
23_E	74_L	1.198	1.00
140_A	144_V	1.171	1.00
69_N	72_A	1.159	1.00
105_A	111_A	1.149	1.00
41_V	98_P	1.142	1.00
40_Y	64_T	1.140	1.00
124_E	128_V	1.133	1.00
106_A	142_Q	1.127	1.00
39_L	94_K	1.126	1.00
7_T	111_A	1.089	1.00
64_T	67_F	1.078	1.00
118_R	146_S	1.071	1.00
69_N	73_A	1.067	1.00
103_L	106_A	1.048	1.00
14_G	40_Y	1.045	1.00
126_G	134_E	1.027	1.00
116_I	133_A	1.016	1.00
71_I	75_A	1.008	1.00
74_L	77_D	0.997	1.00
8_V	113_F	0.996	1.00
24_Y	28_V	0.996	1.00
27_T	31_R	0.988	1.00
57_E	61_A	0.985	1.00
22_A	38_A	0.984	1.00
106_A	111_A	0.982	1.00
39_L	102_I	0.963	1.00
29_A	36_A	0.937	1.00
24_Y	27_T	0.932	1.00
25_A	115_V	0.932	1.00
24_Y	143_P	0.930	1.00
137_L	146_S	0.929	1.00
62_A	66_T	0.925	1.00
73_A	77_D	0.913	1.00
42_L	95_R	0.907	1.00
133_A	146_S	0.901	1.00
12_V	22_A	0.897	1.00
123_E	126_G	0.896	1.00
75_A	79_V	0.895	1.00
9_L	105_A	0.890	1.00
15_T	18_S	0.887	1.00
59_D	62_A	0.886	1.00
9_L	39_L	0.871	1.00
32_Y	112_D	0.871	1.00
58_D	62_A	0.871	1.00
71_I	74_L	0.871	1.00
12_V	38_A	0.862	1.00
18_S	21_A	0.852	1.00
53_G	56_A	0.851	1.00
70_E	73_A	0.847	1.00
25_A	36_A	0.846	1.00
121_M	125_T	0.838	1.00
103_L	140_A	0.834	1.00
12_V	21_A	0.832	1.00
19_V	23_E	0.832	1.00
42_L	93_R	0.827	1.00
9_L	114_V	0.824	1.00
67_F	70_E	0.820	1.00
103_L	136_V	0.819	1.00
118_R	133_A	0.814	1.00
22_A	26_V	0.814	1.00
11_P	117_P	0.809	1.00
73_A	76_P	0.802	1.00
70_E	74_L	0.791	1.00
63_G	66_T	0.780	1.00
69_N	91_T	0.775	1.00
124_E	127_D	0.774	1.00
115_V	145_L	0.770	1.00
20_T	23_E	0.768	1.00
12_V	19_V	0.765	1.00
123_E	127_D	0.755	1.00
12_V	18_S	0.742	1.00
66_T	70_E	0.742	1.00
10_A	36_A	0.739	1.00
55_V	59_D	0.731	1.00
110_D	142_Q	0.725	1.00
102_I	136_V	0.724	1.00
12_V	71_I	0.722	1.00
101_V	105_A	0.720	1.00
29_A	32_Y	0.714	1.00
97_H	100_S	0.712	1.00
15_T	120_G	0.709	1.00
120_G	129_L	0.707	1.00
6_D	112_D	0.707	1.00
28_V	31_R	0.705	1.00
38_A	71_I	0.701	1.00
26_V	30_D	0.698	1.00
39_L	101_V	0.692	1.00
56_A	59_D	0.692	1.00
22_A	71_I	0.691	1.00
8_V	29_A	0.688	1.00
68_L	74_L	0.688	1.00
51_G	55_V	0.686	1.00
63_G	67_F	0.679	1.00
58_D	61_A	0.678	1.00
7_T	34_A	0.676	1.00
29_A	34_A	0.671	1.00
54_D	57_E	0.668	1.00
61_A	64_T	0.661	1.00
23_E	78_G	0.660	1.00
118_R	128_V	0.655	1.00
6_D	34_A	0.654	1.00
68_L	71_I	0.654	1.00
62_A	65_N	0.650	1.00
8_V	115_V	0.649	1.00
28_V	115_V	0.648	1.00
10_A	21_A	0.645	1.00
26_V	75_A	0.642	1.00
99_G	136_V	0.637	1.00
19_V	71_I	0.635	1.00
54_D	58_D	0.632	1.00
59_D	63_G	0.631	1.00
119_E	133_A	0.623	1.00
129_L	133_A	0.622	1.00
60_V	64_T	0.615	1.00
99_G	132_A	0.613	1.00
76_P	91_T	0.607	1.00
99_G	103_L	0.606	1.00
66_T	69_N	0.604	1.00
26_V	79_V	0.601	1.00
75_A	78_G	0.601	1.00
100_S	104_D	0.598	1.00
27_T	30_D	0.589	1.00
107_A	142_Q	0.587	1.00
30_D	79_V	0.585	1.00
137_L	144_V	0.583	1.00
13_D	18_S	0.579	1.00
95_R	101_V	0.578	1.00
116_I	146_S	0.575	1.00
40_Y	67_F	0.569	1.00
99_G	139_Y	0.568	1.00
17_A	20_T	0.562	1.00
51_G	56_A	0.562	1.00
25_A	34_A	0.561	1.00
45_T	48_R	0.555	1.00
67_F	74_L	0.554	1.00
103_L	135_Y	0.553	1.00
72_A	75_A	0.549	1.00
53_G	57_E	0.549	1.00
136_V	144_V	0.541	1.00
38_A	89_F	0.539	1.00
24_Y	147_V	0.535	1.00
28_V	145_L	0.534	1.00
44_E	95_R	0.533	1.00
38_A	75_A	0.525	1.00
64_T	93_R	0.520	1.00
21_A	115_V	0.517	1.00
55_V	58_D	0.513	1.00
96_Q	104_D	0.513	1.00
16_D	19_V	0.512	1.00
46_V	49_A	0.510	1.00
120_G	123_E	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2dumA	2	0.9116	99.9	0.167	Contact Map
1mjhA	2	0.9048	99.9	0.167	Contact Map
5ahwA	4	0.9388	99.9	0.187	Contact Map
3s3tA	4	0.9456	99.9	0.19	Contact Map
3hgmA	2	0.932	99.9	0.196	Contact Map
4wnyA	2	0.8503	99.9	0.202	Contact Map
2gm3A	2	0.8095	99.9	0.202	Contact Map
3tnjA	2	0.8299	99.9	0.204	Contact Map
3fdxA	2	0.8435	99.9	0.205	Contact Map
1tq8A	4	0.8367	99.9	0.211	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.