Q9HMI5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMI5 - Uncharacterized protein

UniProt:	Q9HMI5	Sequences: MPPHDTSDAGASPSAAANPPSSWDALMDDMAAIADDYRDRGWSAHELHPGDVNVSAPTDDAAGRGGIELLVPDNEFEPVAAAFDAADGFDTTRVFRADTSGTVFFVAAVEAAATETAVLVPAYYSPPEHESFTTHLRSAAGSVRLHVRPLDERRVLTFAHDAPELLLPDGG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (151)
Sequences:	125 (99)
Seq/√Len:	8.1

HALSA - Q9HMI5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_V	166_L	5.123	1.00
38_R	44_A	4.523	0.99
37_Y	108_A	3.048	0.89
95_F	108_A	3.041	0.88
132_F	166_L	2.649	0.80
49_P	122_A	2.564	0.78
146_H	157_T	2.339	0.71
49_P	121_P	2.256	0.68
132_F	167_L	2.122	0.63
51_D	97_A	2.110	0.62
93_R	110_E	2.093	0.62
30_M	95_F	2.087	0.61
40_R	107_A	2.087	0.61
91_T	110_E	2.074	0.61
63_G	79_V	1.948	0.56
101_G	132_F	1.932	0.55
76_F	121_P	1.858	0.52
62_A	161_D	1.799	0.50
30_M	46_E	1.777	0.49
160_H	166_L	1.773	0.49
48_H	75_E	1.761	0.48
108_A	117_A	1.757	0.48
26_L	33_I	1.741	0.47
73_D	149_P	1.718	0.46
50_G	72_P	1.627	0.43
52_V	149_P	1.613	0.42
45_H	79_V	1.573	0.41
134_T	142_S	1.553	0.40
95_F	168_P	1.545	0.39
29_D	32_A	1.540	0.39
96_R	150_L	1.537	0.39
32_A	97_A	1.515	0.38
14_S	166_L	1.492	0.37
69_L	107_A	1.481	0.37
34_A	44_A	1.434	0.35
74_N	105_F	1.418	0.35
91_T	129_H	1.411	0.34
122_A	153_R	1.403	0.34
67_I	82_A	1.402	0.34
84_D	118_V	1.396	0.34
89_F	118_V	1.386	0.33
22_S	119_L	1.386	0.33
36_D	42_W	1.383	0.33
162_A	166_L	1.380	0.33
63_G	151_D	1.369	0.33
121_P	153_R	1.338	0.32
49_P	153_R	1.295	0.30
68_E	121_P	1.283	0.30
142_S	147_V	1.278	0.30
15_A	44_A	1.271	0.29
49_P	69_L	1.264	0.29
49_P	76_F	1.264	0.29
73_D	147_V	1.246	0.28
95_F	103_V	1.234	0.28
161_D	166_L	1.228	0.28
121_P	156_L	1.218	0.28
76_F	156_L	1.178	0.26
135_H	166_L	1.171	0.26
118_V	140_A	1.151	0.25
38_R	55_S	1.138	0.25
104_F	165_L	1.138	0.25
85_A	120_V	1.118	0.24
49_P	156_L	1.114	0.24
27_M	135_H	1.114	0.24
150_L	168_P	1.111	0.24
77_E	162_A	1.082	0.23
93_R	131_S	1.068	0.23
52_V	90_D	1.063	0.23
85_A	111_A	1.056	0.23
145_L	160_H	1.032	0.22
104_F	124_Y	1.029	0.22
72_P	120_V	1.013	0.21
27_M	157_T	1.002	0.21
81_A	114_T	0.994	0.21
37_Y	117_A	0.988	0.21
15_A	161_D	0.984	0.21
53_N	104_F	0.951	0.20
43_S	111_A	0.947	0.20
65_G	122_A	0.942	0.19
49_P	75_E	0.939	0.19
38_R	158_F	0.938	0.19
63_G	100_S	0.938	0.19
134_T	169_D	0.935	0.19
93_R	129_H	0.933	0.19
28_D	84_D	0.933	0.19
38_R	161_D	0.923	0.19
37_Y	95_F	0.918	0.19
69_L	121_P	0.917	0.19
36_D	164_E	0.912	0.19
106_V	166_L	0.909	0.19
64_R	167_L	0.905	0.18
118_V	156_L	0.902	0.18
55_S	104_F	0.891	0.18
74_N	98_D	0.890	0.18
107_A	146_H	0.878	0.18
38_R	167_L	0.869	0.18
21_S	92_T	0.866	0.18
105_F	168_P	0.864	0.17
39_D	51_D	0.859	0.17
48_H	121_P	0.855	0.17
47_L	147_V	0.852	0.17
95_F	111_A	0.847	0.17
45_H	51_D	0.837	0.17
52_V	121_P	0.829	0.17
95_F	146_H	0.828	0.17
69_L	120_V	0.819	0.16
142_S	167_L	0.815	0.16
139_A	142_S	0.813	0.16
100_S	118_V	0.808	0.16
72_P	141_G	0.805	0.16
50_G	150_L	0.804	0.16
52_V	112_A	0.803	0.16
49_P	52_V	0.800	0.16
54_V	164_E	0.799	0.16
81_A	137_R	0.796	0.16
51_D	141_G	0.794	0.16
43_S	104_F	0.793	0.16
21_S	147_V	0.777	0.16
44_A	161_D	0.775	0.15
140_A	143_V	0.774	0.15
45_H	141_G	0.767	0.15
83_F	156_L	0.766	0.15
70_L	73_D	0.762	0.15
140_A	145_L	0.747	0.15
18_N	100_S	0.737	0.15
127_P	136_L	0.735	0.15
79_V	156_L	0.734	0.15
90_D	112_A	0.729	0.15
39_D	114_T	0.723	0.14
50_G	75_E	0.721	0.14
62_A	158_F	0.719	0.14
159_A	165_L	0.719	0.14
147_V	169_D	0.718	0.14
84_D	139_A	0.714	0.14
76_F	153_R	0.709	0.14
63_G	114_T	0.706	0.14
68_E	76_F	0.701	0.14
94_V	167_L	0.700	0.14
101_G	127_P	0.699	0.14
103_V	137_R	0.696	0.14
29_D	166_L	0.696	0.14
73_D	152_E	0.696	0.14
33_I	123_Y	0.693	0.14
66_G	124_Y	0.693	0.14
63_G	77_E	0.690	0.14
105_F	126_P	0.688	0.14
69_L	156_L	0.682	0.14
71_V	169_D	0.678	0.13
61_A	74_N	0.678	0.13
25_A	83_F	0.677	0.13
33_I	48_H	0.676	0.13
33_I	76_F	0.675	0.13
45_H	99_T	0.670	0.13
101_G	146_H	0.669	0.13
109_V	144_R	0.662	0.13
46_E	144_R	0.659	0.13
122_A	156_L	0.652	0.13
119_L	140_A	0.649	0.13
41_G	98_D	0.648	0.13
85_A	131_S	0.646	0.13
110_E	126_P	0.646	0.13
111_A	158_F	0.639	0.13
62_A	125_S	0.638	0.13
79_V	118_V	0.635	0.13
118_V	149_P	0.631	0.13
37_Y	69_L	0.629	0.13
15_A	38_R	0.625	0.13
136_L	147_V	0.623	0.12
77_E	94_V	0.621	0.12
16_A	166_L	0.620	0.12
52_V	122_A	0.620	0.12
62_A	93_R	0.619	0.12
47_L	145_L	0.618	0.12
13_P	16_A	0.615	0.12
45_H	82_A	0.608	0.12
96_R	168_P	0.607	0.12
117_A	163_P	0.607	0.12
62_A	140_A	0.606	0.12
107_A	148_R	0.605	0.12
37_Y	154_R	0.599	0.12
72_P	150_L	0.593	0.12
103_V	168_P	0.587	0.12
30_M	156_L	0.584	0.12
41_G	135_H	0.582	0.12
28_D	157_T	0.580	0.12
77_E	84_D	0.578	0.12
93_R	154_R	0.577	0.12
31_A	65_G	0.576	0.12
28_D	83_F	0.576	0.12
30_M	136_L	0.573	0.12
153_R	156_L	0.571	0.12
15_A	94_V	0.564	0.11
29_D	161_D	0.562	0.11
88_G	137_R	0.562	0.11
26_L	78_P	0.560	0.11
54_V	132_F	0.559	0.11
18_N	22_S	0.558	0.11
49_P	68_E	0.556	0.11
131_S	139_A	0.555	0.11
86_A	90_D	0.555	0.11
15_A	60_D	0.555	0.11
39_D	134_T	0.553	0.11
68_E	148_R	0.550	0.11
82_A	113_A	0.550	0.11
29_D	105_F	0.546	0.11
39_D	43_S	0.546	0.11
133_T	164_E	0.541	0.11
115_E	130_E	0.537	0.11
13_P	77_E	0.535	0.11
150_L	164_E	0.534	0.11
66_G	146_H	0.534	0.11
74_N	149_P	0.531	0.11
43_S	73_D	0.529	0.11
66_G	160_H	0.527	0.11
95_F	105_F	0.526	0.11
104_F	148_R	0.524	0.11
143_V	167_L	0.522	0.11
107_A	151_D	0.518	0.11
40_R	157_T	0.515	0.11
71_V	80_A	0.513	0.11
23_W	27_M	0.512	0.11
28_D	127_P	0.509	0.11
45_H	89_F	0.509	0.11
45_H	161_D	0.504	0.10
102_T	152_E	0.504	0.10
76_F	155_V	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lmcA	1	0.2456	33.3	0.942	Contact Map
1ps9A	1	0.8947	30.3	0.944	Contact Map
3hgjA	2	0.8947	24.1	0.946	Contact Map
3gr7A	3	0.883	15.4	0.951	Contact Map
1z41A	3	0.883	13.7	0.952	Contact Map
1b25A	3	0.3918	11.9	0.953	Contact Map
3l5lA	2	0.8947	10.2	0.954	Contact Map
4l4wA	1	0.7485	8.1	0.956	Contact Map
3kruA	3	0.8889	6.9	0.958	Contact Map
3gkaA	1	0.9064	5.3	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.